SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|121596676|ref|YP_991228.1| from Burkholderia mallei SAVP1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|121596676|ref|YP_991228.1|
Domain Number 1 Region: 69-478
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 4.86e-129
Family TK-like PP module 0.000000000634
Further Details:      
 
Domain Number 2 Region: 485-710
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 2.12e-92
Family TK-like Pyr module 0.000000102
Further Details:      
 
Domain Number 3 Region: 720-903
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 2.62e-49
Family Transketolase C-terminal domain-like 0.0000238
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|121596676|ref|YP_991228.1|
Sequence length 907
Comment 2-oxoacid dehydrogenase subunit E1 [Burkholderia mallei SAVP1]
Sequence
MNDLSNGIRPVLATARRHDDTDPQETAEWLDALDGVVAHAGAERAQYLLAQLAEHAARRR
LAPPHAGATPYVNTIPVDEEPPYPGDLQLEERLAAVLRWNALAMVVRANRAYGELGGHIA
SYASAADLFEVGFNHFFRAAGDASGGDLVYFQPHSSPGVYARAFLEGFLSDAQLEHYRRE
IAGPGLCSYPHPWLMPDFWQFPTGSMGIGPINAIYQARFMRYLQNRGLLRTEGRKVWGFF
GDGEMDEPESIGALSLAAREGLDNLVFVINCNLQRLDGPVRGNGRIVDELESQFAGAGWN
VIKVLWGSDWDALFARDATGALARAFAQTVDGQFQTFSANDGAYNRARFFGQNDALAALV
AHLRDEDIDRLRRGGHDARKLYAAYERAVRHEGRPTVILAKTMKGFGLGAIGQGRMTTHQ
QKKLDVEHLLAFRDRFRLPLTDEDVAQLRFYRPEKDSPEMRYLHARRAALGGCLPRRRAA
ATAALTVPSLPSWGQFALDGGREMSTTMAIVRMLGGLLKDAALGPRIVPIVADEARTFGM
ANLFRQVGIYSPLGQRYEPEDLGSMLYYREDTRGQILEEGISEAGAISSWIAAATSYSVH
DLPMLPFYIYYSMFGFQRIGDLIWAAADQRARGFLIGATSGKTTLGGEGLQHQDGTSHLA
ASTVPNCRAWDPAFAYEIAVIVDEGMREMVERQRDTFYYLTVTNENHAQPTLPADRLDAV
RGGILKGMYPLDAAALPAARVQLLGSGAILGEVQAAARLLRDDWRIDAAVWSVTSFTELQ
RDGIAAERAQRLFDADDANERSPTPHVTSALAATQGPVIAATDYARALPELIRAYVPRRY
VTLGTDGFGRSDTREALRAFFEVDRGSIVIAALRALADDGEVTRTVVRDAIARYGKRDAS
RTPPWER
Download sequence
Identical sequences A0A0H2WB09 A0A290YFN9 A2S119 C4B2Q9
gi|121596676|ref|YP_991228.1| gi|126445627|ref|YP_001077713.1| WP_004187349.1.100104 WP_004187349.1.100727 WP_004187349.1.13925 WP_004187349.1.20531 WP_004187349.1.21442 WP_004187349.1.22329 WP_004187349.1.22625 WP_004187349.1.23385 WP_004187349.1.26445 WP_004187349.1.28453 WP_004187349.1.29148 WP_004187349.1.31831 WP_004187349.1.3251 WP_004187349.1.33419 WP_004187349.1.33543 WP_004187349.1.34747 WP_004187349.1.35757 WP_004187349.1.35878 WP_004187349.1.38946 WP_004187349.1.39349 WP_004187349.1.40191 WP_004187349.1.41477 WP_004187349.1.43899 WP_004187349.1.44540 WP_004187349.1.4810 WP_004187349.1.48313 WP_004187349.1.48407 WP_004187349.1.53977 WP_004187349.1.54892 WP_004187349.1.57679 WP_004187349.1.61073 WP_004187349.1.61588 WP_004187349.1.66594 WP_004187349.1.67393 WP_004187349.1.72545 WP_004187349.1.72798 WP_004187349.1.74675 WP_004187349.1.75230 WP_004187349.1.75861 WP_004187349.1.78557 WP_004187349.1.82283 WP_004187349.1.84063 WP_004187349.1.84480 WP_004187349.1.9281 WP_004187349.1.95952 WP_004187349.1.96660 WP_004187349.1.98066 YP_106297.1.87047 gi|124382922|ref|YP_001025639.1| 243160.BMAA1737 320388.BMASAVP1_1634 320389.BMA10247_A0512 412022.BMA10229_1842 gi|53716156|ref|YP_106297.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]