SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|121598598|ref|YP_991739.1| from Burkholderia mallei SAVP1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|121598598|ref|YP_991739.1|
Domain Number 1 Region: 22-339
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 3.33e-120
Family TK-like PP module 0.00000000148
Further Details:      
 
Domain Number 2 Region: 369-548
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 4.02e-62
Family TK-like Pyr module 0.00000264
Further Details:      
 
Domain Number 3 Region: 557-690
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 3.4e-44
Family Transketolase C-terminal domain-like 0.0000175
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|121598598|ref|YP_991739.1|
Sequence length 690
Comment transketolase [Burkholderia mallei SAVP1]
Sequence
MPPVPRFLDSFSGLDMTTSSPASTTLMANAIRALAMDAVQQANSGHPGMPMGMAEIGVAL
WSRHLKHNPTTPHWADRDRFVLSNGHGSMLLYSLLHLTGYDLPIEELKNFRQLHSKTPGH
PEYGITPGVETTTGPLGQGLANAVGMALGEALLAAEFNRDDAKIVDHHTYVFVGDGCLME
GISHEACSLAGTLKLNKLIAFYDDNGISIDGDVVNWFHDDTPKRFEAYGWNVIPNVNGHD
VDAVDAAIAKAKSADKPTLICCKTVIGKGAATKAGGHDVHGAALGAEEIAKTRDALGWKW
APFVIPQEVYAAWDAKEAGKRREGDWNAAFAQYRAKYPAEAAEFERRMAGKLPADWAEKA
AAIVAGANERGETVATRKASQQTIEGLAAVLPELLGGSADLTGSNLTNWKASKAVRANAH
GAGIQWGNHINYGVREFGMSAAINGLVLHGGYKPFGGTFLTFSDYSRNALRVAALMKVPS
IFVFTHDSIGLGEDGPTHQSVEHVASLRLIPNLDVWRPADTVETAVAWTHAVSHQHPSCL
VFSRQNLAFNARTDAQLANIEKGGYVLRDWDEEIVARKIILIATGSEVELAMKAVEPLAQ
QGIAARVVSMPSTDVFDRQDAEYRERVLPHGVRRVAIEAGVTDFWRKYVGLEGGVVGIDT
FGESAPAGVLFKHFGFTIEHVVETAKAVLA
Download sequence
Identical sequences A0A0H2WJE4 A0A290YBN0 A2S5L4
WP_004194304.1.100104 WP_004194304.1.100727 WP_004194304.1.13925 WP_004194304.1.20531 WP_004194304.1.21442 WP_004194304.1.22329 WP_004194304.1.22625 WP_004194304.1.23385 WP_004194304.1.26445 WP_004194304.1.28453 WP_004194304.1.29148 WP_004194304.1.31831 WP_004194304.1.3251 WP_004194304.1.33419 WP_004194304.1.33543 WP_004194304.1.34747 WP_004194304.1.35757 WP_004194304.1.35878 WP_004194304.1.38946 WP_004194304.1.39349 WP_004194304.1.41477 WP_004194304.1.43899 WP_004194304.1.44540 WP_004194304.1.4810 WP_004194304.1.48313 WP_004194304.1.48407 WP_004194304.1.53977 WP_004194304.1.54892 WP_004194304.1.57679 WP_004194304.1.61073 WP_004194304.1.61588 WP_004194304.1.66594 WP_004194304.1.67393 WP_004194304.1.69508 WP_004194304.1.72545 WP_004194304.1.72798 WP_004194304.1.74675 WP_004194304.1.75230 WP_004194304.1.75861 WP_004194304.1.78557 WP_004194304.1.79653 WP_004194304.1.82283 WP_004194304.1.84063 WP_004194304.1.84480 WP_004194304.1.9236 WP_004194304.1.9281 WP_004194304.1.95952 WP_004194304.1.96660 WP_004194304.1.98066 YP_104015.1.87047 gi|53725663|ref|YP_104015.1| 243160.BMA2469 320388.BMASAVP1_A0389 412022.BMA10229_A1249 gi|121598598|ref|YP_991739.1| gi|124383722|ref|YP_001027233.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]