SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|120556764|ref|YP_961115.1| from Marinobacter aquaeolei VT8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|120556764|ref|YP_961115.1|
Domain Number 1 Region: 15-164,213-383
Classification Level Classification E-value
Superfamily Acetamidase/Formamidase-like 8.5e-82
Family Acetamidase/Formamidase-like 0.00057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|120556764|ref|YP_961115.1|
Sequence length 410
Comment formamidase [Marinobacter aquaeolei VT8]
Sequence
MAETLIKIDLSKSAYENENIHNRWHPDIPMAATVKPGDDFILECYDWTGGQIKNNDSADD
VRDVDLTQVHFLSGPVGVEGAEPGDLLEVDILDIGAFKDSQWGFNGFFSKKNGGGFLTEH
FPEAQKSIWDFNGMFTKSRHIPNVEFAGMIHPGLIGCLPSKEMLAEWNKREKELYDTEPD
RVPGLANLPYADTAHLGKLAGDAAKEAALEAARTVPPREHGGNCDIKDLSRGSKVYFPVY
VKGAGLSVGDLHFSQGDGEITFCGAIEMAGWIHLRVNLIKDGMAKYGIKNPVFKPSSIKP
RYEDYVIFEGISVDEEGQQHYLDVHVAYRQACLNAINYLTKFGYTPAQGYALLGCAPVEG
HISGVVDVPNACATLWLPTEIFDFDINPTAEGPTRKVTPGTDVPLSPDKE
Download sequence
Identical sequences A1U7F9 H8WA44 U7H597
351348.Maqu_3860 gi|387816191|ref|YP_005431686.1| gi|120556764|ref|YP_961115.1| WP_011787261.1.7233 WP_011787261.1.74965 WP_011787261.1.95793

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]