SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|120553720|ref|YP_958071.1| from Marinobacter aquaeolei VT8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|120553720|ref|YP_958071.1|
Domain Number 1 Region: 18-186
Classification Level Classification E-value
Superfamily SIS domain 2.83e-45
Family mono-SIS domain 0.0000122
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|120553720|ref|YP_958071.1|
Sequence length 194
Comment phosphoheptose isomerase [Marinobacter aquaeolei VT8]
Sequence
MSQQSSYLATLERHRKTFAVMEEHQEAVEQLLELTRQSLKRGGKIIFLGNGGSAADSQHL
AAEFMVRYKKERGPLASIALTTDTSILTAHPNDYEFETVFERQVLGLGKPEDLVIGLTTS
GQSENINRALKAANDLGAATVALTGRDGGKVRDIAKLSIIIRSDETARIQEAHMFIGHWL
CEAMDEVVLSGGLD
Download sequence
Identical sequences A1TYR5 U7P222
WP_011784306.1.60619 WP_011784306.1.7233 gi|120553720|ref|YP_958071.1| 351348.Maqu_0787

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]