SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|120555376|ref|YP_959727.1| from Marinobacter aquaeolei VT8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|120555376|ref|YP_959727.1|
Domain Number 1 Region: 4-194
Classification Level Classification E-value
Superfamily SIS domain 4.45e-37
Family mono-SIS domain 0.00000795
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|120555376|ref|YP_959727.1|
Sequence length 196
Comment phosphoheptose isomerase [Marinobacter aquaeolei VT8]
Sequence
MTDTEQRINQWFASHMEHTAQAASTAGPAIEQVAQAFVDALLQDGKIITCANGNANVLAQ
YFCTALLSRFDQDRPALPAINLGADATTYSAICRDNRFNDTFSRQVRAIGKPGDLLFVIV
DDGHKANLIQAIQAAHDREMRIVVLSAREKSDITSLMHPEDHEIALNDLPPSEATPLLLV
IINAFCDLIDHKLFGG
Download sequence
Identical sequences A0A2D9LCL0 A1U3H1 H8W648 U7HEX7 U7NRK6 U7NZJ0
WP_011785924.1.55946 WP_011785924.1.60619 WP_011785924.1.7233 WP_011785924.1.74965 WP_011785924.1.95793 351348.Maqu_2465 gi|387813205|ref|YP_005428687.1| gi|120555376|ref|YP_959727.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]