SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|120555621|ref|YP_959972.1| from Marinobacter aquaeolei VT8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|120555621|ref|YP_959972.1|
Domain Number 1 Region: 6-326
Classification Level Classification E-value
Superfamily SIS domain 1.4e-71
Family mono-SIS domain 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|120555621|ref|YP_959972.1|
Sequence length 329
Comment KpsF/GutQ family protein [Marinobacter aquaeolei VT8]
Sequence
MTESNTFNTQDFCNSALRAIRIEREAIEALESRINGDFSRACEVIMACKGRVVVTGMGKS
GHIGNKIAATLASTGTPAFFVHPGEASHGDLGMITPQDVVIAISNSGSTSEVVTILPLIK
RMGAPLISMTGKPDSVLAQEAVANLDVSVAIEACPLGLAPTSSTTATLVMGDALAVALLE
ARGFSAEDFAFSHPGGSLGRRLLLRVSDIMHTGDQIPQVAEGTTLSGALLEITRKGLGMT
TVVNAAGTLTGIFTDGDLRRTLDKSVDVHTTPIQDVMTRNGKTIRADHLAAEALNIMEEM
KINALPVTDANGTLVGAINMHDLLRAGVI
Download sequence
Identical sequences A0A2E5N6U8 A1U466 H8WAQ5 U7NPN6
351348.Maqu_2710 gi|120555621|ref|YP_959972.1| gi|387814994|ref|YP_005430481.1| WP_011786155.1.60619 WP_011786155.1.7233 WP_011786155.1.95793

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]