SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|116495107|ref|YP_806841.1| from Lactobacillus casei ATCC 334

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|116495107|ref|YP_806841.1|
Domain Number 1 Region: 4-207
Classification Level Classification E-value
Superfamily Formyltransferase 1.31e-59
Family Formyltransferase 0.00000719
Further Details:      
 
Domain Number 2 Region: 205-305
Classification Level Classification E-value
Superfamily FMT C-terminal domain-like 1.31e-21
Family Post formyltransferase domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|116495107|ref|YP_806841.1|
Sequence length 318
Comment methionyl-tRNA formyltransferase [Lactobacillus casei ATCC 334]
Sequence
MTSVIFLGTPEFAVPILEGLIAQHYDILAVMTQPDRKVGRKLRLAASPVKQAAQKHDIPV
LQPEKLSGSPELAQAIAMAPDLIVTAAYGQFLPTKFLEAAKIIAVNVHGSLLPKYRGGAP
IQYSIMNGDSETGVTIIEMVKKMDAGDMFAQAKLPLTRADDTGTVFAKLSLLGRDLLLET
LPKIIAGTATRTPQDPDKVTFSPTITKEQEHLNIHLPAKALDQWIRALRPDVGGYVYLNG
QRTKLWAITPLSAGSTLPAGSIVERDKHRLVMVAGQQTTFQVDELQPAGKAKQSIADFLN
GPGQQLVSGQQVITDDPE
Download sequence
Identical sequences Q038H3
gi|116495107|ref|YP_806841.1| 321967.LSEI_1625 WP_011674552.1.31893 WP_011674552.1.49750 YP_806841.1.65993

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]