SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|116495228|ref|YP_806962.1| from Lactobacillus casei ATCC 334

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|116495228|ref|YP_806962.1|
Domain Number 1 Region: 4-186
Classification Level Classification E-value
Superfamily Formyltransferase 8.63e-50
Family Formyltransferase 0.0000366
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|116495228|ref|YP_806962.1|
Sequence length 189
Comment folate-dependent phosphoribosylglycinamide formyltransferase PurN [Lactobacillus casei ATCC 334]
Sequence
MKDLAVFASGHGTNFEALANAADQPDSGYRIAALVCDQSQAPVIQKAAARNILTIVVDFK
SYPNKTAAETAILEQLPPVSALILAGYMRIIGPTLLRAFPKKIINLHPALLPSFPGRQGI
QDAFDYGVKVTGVTVHFVDAGIDTGEIIAQVPVNITDGMSLAELEQAIHRQEHQIFPATV
KNLIQEGAI
Download sequence
Identical sequences A0A0E1PKA5 A0A0E2BQ10 A0A0R1FD38 A0A1V0Q2G7 C2FER6 K6QQD5 Q037V2 S2QHI9
gi|532357173|ref|YP_008447007.1| WP_003565971.1.12579 WP_003565971.1.13963 WP_003565971.1.25941 WP_003565971.1.29913 WP_003565971.1.31893 WP_003565971.1.3835 WP_003565971.1.42997 WP_003565971.1.44983 WP_003565971.1.49750 WP_003565971.1.57088 WP_003565971.1.58515 WP_003565971.1.65183 WP_003565971.1.67564 WP_003565971.1.7166 WP_003565971.1.72586 WP_003565971.1.82183 WP_003565971.1.91737 WP_003565971.1.91826 WP_003565971.1.96019 WP_003565971.1.9892 WP_003565971.1.99959 YP_806962.1.65993 321967.LSEI_1748 gi|116495228|ref|YP_806962.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]