SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|116326670|ref|YP_796444.1| from Lactobacillus casei ATCC 334

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|116326670|ref|YP_796444.1|
Domain Number 1 Region: 10-262
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.39e-61
Family Phosphate binding protein-like 0.000000857
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|116326670|ref|YP_796444.1|
Sequence length 284
Comment amino acid ABC transporter periplasmic protein [Lactobacillus casei ATCC 334]
Sequence
MKKRLFTRIIAVVSVFAALLLVLTGCGNSKKSSSQSNNPSSVQQIKKNGTIRIAVFGDLP
PYGWVNKDGKRVGYDVTLAHQVAKDLGVKVKFVQVNANNRVDALNSNKVDLVLANFTVTP
ERKQVIDFAKPYMKVSVGVVSPKNKAITKASQLKGKNVIVTKGTTAENYFTSKQPDVKLL
KFDSKTQQFNALKNGRGVALADDNSYLYAWSKDNPSYTVGIKSIGPKSYIAPAVKKGNKS
LLNWTNKEINKLTKQSFFVKDYNTQLKPYFGKEVKPSDIVLPVK
Download sequence
Identical sequences A0A0R1F721 A0A249N5Z3 A0A291J0G0 Q033J3
gi|116326670|ref|YP_796444.1|NC_008502 WP_011669024.1.31893 WP_011669024.1.49750 WP_011669024.1.51722 WP_011669024.1.61849 WP_011669024.1.72055 WP_011669024.1.76241 WP_011669024.1.96492 WP_011669024.1.98897 WP_011669024.1.99828 YP_796444.1.65993 321967.LSEI_A12 gi|116326670|ref|YP_796444.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]