SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|116493636|ref|YP_805370.1| from Lactobacillus casei ATCC 334

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|116493636|ref|YP_805370.1|
Domain Number 1 Region: 34-304
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 3.58e-68
Family Phosphate binding protein-like 0.0000124
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|116493636|ref|YP_805370.1|
Sequence length 309
Comment glycine betaine/choline ABC transporter substrate-binding protein [Lactobacillus casei ATCC 334]
Sequence
MKTFRKMLLSLFLIPVLLLGGCGFPGLGGSGNDGTVRIASQTSTESQIMANIIAELINHE
LGYKTTLVNNLGSGTVVHQAMIRNDADISATRYTGTDITGTLGMNPVKDPAEATAIVKRE
FKKRYDQTWYPSYGFSDTYAFMVTQQEAKKDGLSTISDLKKVASRYNAGVDSSWMNRKGD
GYSDFTKMYGFDFKRVYPMQIGLVYDAVEANKMQTVLGYSTDGRIRSYNLKVLKDDKKFF
PPYQCSLVVNNSFLKKYPKLKPLLHRLDGKINLKTMQELNYQVDDQLLEPNVVAQKFLAK
HNYFKGSDD
Download sequence
Identical sequences A0A0B8TN88 A0A0C9QSC9 A0A0E1PJ21 A0A0E2BV99 A0A0E2MCG9 A0A0K1MQP3 A0A0R1F9T4 A0A125YC94 A0A1F1JVA7 A0A2I5MET3 C2FAY6 K6Q1Y5 K6R0T5 K6R731 K6S7A7 K6SVQ1 Q03CZ4 S2NEF4 S2P912 S2Q1E6 S2S2L8 S2S6U7 S2TZM8 S4ZIA2
gi|301065198|ref|YP_003787221.1| gi|385818592|ref|YP_005854979.1| 321967.LSEI_0064 gi|116493636|ref|YP_805370.1| gi|523512559|ref|YP_008198643.1| WP_003562594.1.11857 WP_003562594.1.13158 WP_003562594.1.13224 WP_003562594.1.13963 WP_003562594.1.1450 WP_003562594.1.16432 WP_003562594.1.16871 WP_003562594.1.18077 WP_003562594.1.1932 WP_003562594.1.20005 WP_003562594.1.2136 WP_003562594.1.22898 WP_003562594.1.24721 WP_003562594.1.24722 WP_003562594.1.25220 WP_003562594.1.25941 WP_003562594.1.26583 WP_003562594.1.29319 WP_003562594.1.31893 WP_003562594.1.33776 WP_003562594.1.348 WP_003562594.1.3835 WP_003562594.1.39141 WP_003562594.1.40478 WP_003562594.1.42997 WP_003562594.1.43124 WP_003562594.1.44079 WP_003562594.1.44847 WP_003562594.1.44983 WP_003562594.1.45488 WP_003562594.1.45928 WP_003562594.1.46604 WP_003562594.1.48252 WP_003562594.1.49406 WP_003562594.1.49750 WP_003562594.1.505 WP_003562594.1.52467 WP_003562594.1.54691 WP_003562594.1.56780 WP_003562594.1.56814 WP_003562594.1.57088 WP_003562594.1.58515 WP_003562594.1.6012 WP_003562594.1.61849 WP_003562594.1.62572 WP_003562594.1.63838 WP_003562594.1.64430 WP_003562594.1.65183 WP_003562594.1.66157 WP_003562594.1.67371 WP_003562594.1.67564 WP_003562594.1.6844 WP_003562594.1.69447 WP_003562594.1.698 WP_003562594.1.7166 WP_003562594.1.72586 WP_003562594.1.73866 WP_003562594.1.74575 WP_003562594.1.74597 WP_003562594.1.78295 WP_003562594.1.7925 WP_003562594.1.80634 WP_003562594.1.8164 WP_003562594.1.82183 WP_003562594.1.86624 WP_003562594.1.88086 WP_003562594.1.90364 WP_003562594.1.91063 WP_003562594.1.91737 WP_003562594.1.91826 WP_003562594.1.92090 WP_003562594.1.94863 WP_003562594.1.96019 WP_003562594.1.98013 WP_003562594.1.98897 WP_003562594.1.9892 WP_003562594.1.99959 YP_805370.1.65993 gi|385821764|ref|YP_005858106.1| gi|532355582|ref|YP_008445416.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]