SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|116493942|ref|YP_805676.1| from Lactobacillus casei ATCC 334

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|116493942|ref|YP_805676.1|
Domain Number 1 Region: 75-304
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 2.26e-69
Family Phosphate binding protein-like 0.0000321
Further Details:      
 
Weak hits

Sequence:  gi|116493942|ref|YP_805676.1|
Domain Number - Region: 23-79
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00206
Family GntR-like transcriptional regulators 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|116493942|ref|YP_805676.1|
Sequence length 304
Comment transcriptional regulator [Lactobacillus casei ATCC 334]
Sequence
MQAYQYQKKGLALIFLAKKFFVLKVGDRVPTVTEMINESELSRGTIQAGLELMKADGAIS
TISKGHLGSFLVAQDQDKLLSYLDYRNVVCAMPLPYTKHYEGLGTGLYKAFKNQKLGLNV
AYVNESVNRLEGLQRNRYDFIIVSALTADYLAEHHDVDVVGIMPEGSYVSQHVIVYKGDQ
DFKMRDGLRIGIDSHSLDYKLMTNKILEKHKVELVESPYNQIVQRIVAGEIDAAIWNLDE
VKSKNYPLGYQMIKDPMVKRASRAAILCAKGNGFVKRVIGDYVDFKEVTAIQKQVISGEV
LPEY
Download sequence
Identical sequences Q03C38
WP_011674092.1.31893 WP_011674092.1.49750 YP_805676.1.65993 321967.LSEI_0376 gi|116493942|ref|YP_805676.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]