SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|116494012|ref|YP_805746.1| from Lactobacillus casei ATCC 334

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|116494012|ref|YP_805746.1|
Domain Number 1 Region: 12-106
Classification Level Classification E-value
Superfamily Enzyme IIa from lactose specific PTS, IIa-lac 2.22e-29
Family Enzyme IIa from lactose specific PTS, IIa-lac 0.0006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|116494012|ref|YP_805746.1|
Sequence length 121
Comment PTS system cellobiose-specific transporter subunit IIA [Lactobacillus casei ATCC 334]
Sequence
MTQKDTNESPLIPVAMQIIIYAGNGRNKALEAVQLAKNKQLAAAYQALASAKKEITLAHQ
AQTEIIQNEAAGRHYEPSLLFTHAQDHLMTIASEISMTENMIELFEVVLTDAVSSNQPSS
I
Download sequence
Identical sequences A0A0C9Q9Z5 A0A0E2LVS2 A0A125U538 A0A1Y2KSV2 A0A2I5MG07 K6QPZ5 K6SNI1 Q03BW8 S2NDN0 S2QTP6 S2SMW7
321967.LSEI_0449 543734.LCABL_05150 gi|385822211|ref|YP_005858553.1| WP_003573646.1.12579 WP_003573646.1.13158 WP_003573646.1.13224 WP_003573646.1.15772 WP_003573646.1.20005 WP_003573646.1.24722 WP_003573646.1.25220 WP_003573646.1.25941 WP_003573646.1.26583 WP_003573646.1.29319 WP_003573646.1.29913 WP_003573646.1.31893 WP_003573646.1.33776 WP_003573646.1.3518 WP_003573646.1.39141 WP_003573646.1.39238 WP_003573646.1.44079 WP_003573646.1.44847 WP_003573646.1.45928 WP_003573646.1.46604 WP_003573646.1.48728 WP_003573646.1.49750 WP_003573646.1.56780 WP_003573646.1.57088 WP_003573646.1.6012 WP_003573646.1.61849 WP_003573646.1.62572 WP_003573646.1.63838 WP_003573646.1.7209 WP_003573646.1.78295 WP_003573646.1.88086 WP_003573646.1.90364 WP_003573646.1.916 WP_003573646.1.94863 WP_003573646.1.98897 YP_805746.1.65993 2005369617 gi|385819047|ref|YP_005855434.1| gi|116494012|ref|YP_805746.1| gi|191637333|ref|YP_001986499.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]