SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|116494443|ref|YP_806177.1| from Lactobacillus casei ATCC 334

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|116494443|ref|YP_806177.1|
Domain Number 1 Region: 31-275
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 8.9e-75
Family Phosphate binding protein-like 0.0000486
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|116494443|ref|YP_806177.1|
Sequence length 286
Comment phosphate ABC transporter periplasmic protein [Lactobacillus casei ATCC 334]
Sequence
MKKIVTLLSLLFLPLLISACNSSSQQSGESITAVGSSALQPLVEAAGEQYQTEHLGVFIN
VQGGGSGTGLSQIQQGAVDIGNSDLFAEEKAGIKAKALVDHKVAVVGIAPIVNPKVGVKN
VSMAQLQKIFLGEITNWQQLGGKNVPIVLVNRAQGSGTRATFEKCVMQGKQPMAAQEQDS
TGMVRQIVGSTPGAISYVAFSYIDKTVQGLSVDGVAPTDANVTTNQWRIWSYEHMYTKGQ
PKGLTKKFLAYVMSPAIQKKLVLKMGYVPMTQMKVVRDANGKVSKQ
Download sequence
Identical sequences A0A0R1F4I7 Q03AN7
WP_011674324.1.31893 WP_011674324.1.49750 YP_806177.1.65993 gi|116494443|ref|YP_806177.1| 321967.LSEI_0936

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]