SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|116494773|ref|YP_806507.1| from Lactobacillus casei ATCC 334

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|116494773|ref|YP_806507.1|
Domain Number 1 Region: 44-291
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 6.76e-71
Family Phosphate binding protein-like 0.0000623
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|116494773|ref|YP_806507.1|
Sequence length 301
Comment phosphate ABC transporter periplasmic protein [Lactobacillus casei ATCC 334]
Sequence
MKHSKLFVGLTVALAATLVLAGCGSKSASSSSKSSSAPIKQSKILAVGSTALQPLVEQAA
KQYQTDNPKAEITVQGGGSGAGLSQVAAGSVTIGNSDIFAQEKSDLKADDLVDHQVAVVA
IAPVVNKDAGVKNISTQQLVDIFQGKITNWKEVGGKDQAIVLINRAQGSGTRATFEQFGI
KTNKVKTSQEQDSSGTVYQMVSTTPGAISYLAFSAIKDGVQKLALNHVQPTDKNVTTNTW
KIWAYEHMYTKGKPNASTAAFINYIQSKNVQKTLVPKLGYIPVTQMTVARTHDGKIEEIN
K
Download sequence
Identical sequences A0A0E1PGX9 A0A0E2BRP4 A0A0E2MDM5 A0A0R1F3Z3 A0A0R2DX67 A0A125U7A1 A0A1F1JP00 A0A1J3CBA5 A0A2I5MI19 C2FG07 K6PNI3 K6QRK1 K6RBZ3 K6RFY5 Q039Q7 S2NEH4 S2RDT4 S2SL80 S4ZLM7
gi|385823185|ref|YP_005859527.1| gi|523513894|ref|YP_008199978.1| gi|191638286|ref|YP_001987452.1| gi|116494773|ref|YP_806507.1| WP_003565182.1.11857 WP_003565182.1.13158 WP_003565182.1.13224 WP_003565182.1.1450 WP_003565182.1.15772 WP_003565182.1.16432 WP_003565182.1.16871 WP_003565182.1.18077 WP_003565182.1.1932 WP_003565182.1.20005 WP_003565182.1.2136 WP_003565182.1.22898 WP_003565182.1.24722 WP_003565182.1.24935 WP_003565182.1.25220 WP_003565182.1.25941 WP_003565182.1.26583 WP_003565182.1.28075 WP_003565182.1.29319 WP_003565182.1.31893 WP_003565182.1.33776 WP_003565182.1.3518 WP_003565182.1.35591 WP_003565182.1.3835 WP_003565182.1.39141 WP_003565182.1.39238 WP_003565182.1.39264 WP_003565182.1.40478 WP_003565182.1.42997 WP_003565182.1.44079 WP_003565182.1.44847 WP_003565182.1.44983 WP_003565182.1.45488 WP_003565182.1.45928 WP_003565182.1.46604 WP_003565182.1.48252 WP_003565182.1.48728 WP_003565182.1.49406 WP_003565182.1.49750 WP_003565182.1.505 WP_003565182.1.56780 WP_003565182.1.56814 WP_003565182.1.58515 WP_003565182.1.6012 WP_003565182.1.62572 WP_003565182.1.63838 WP_003565182.1.65183 WP_003565182.1.66157 WP_003565182.1.67371 WP_003565182.1.67564 WP_003565182.1.6844 WP_003565182.1.698 WP_003565182.1.7166 WP_003565182.1.7209 WP_003565182.1.72586 WP_003565182.1.73866 WP_003565182.1.74597 WP_003565182.1.75061 WP_003565182.1.78295 WP_003565182.1.7925 WP_003565182.1.80634 WP_003565182.1.86624 WP_003565182.1.88086 WP_003565182.1.90364 WP_003565182.1.91063 WP_003565182.1.916 WP_003565182.1.91737 WP_003565182.1.91826 WP_003565182.1.92090 WP_003565182.1.94863 WP_003565182.1.96019 WP_003565182.1.98013 WP_003565182.1.99959 YP_806507.1.65993 gi|532356680|ref|YP_008446514.1| gi|301066335|ref|YP_003788358.1| 321967.LSEI_1282 543734.LCABL_15130

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]