SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|116494920|ref|YP_806654.1| from Lactobacillus casei ATCC 334

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|116494920|ref|YP_806654.1|
Domain Number 1 Region: 2-204
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 6.74e-60
Family Phosphate binding protein-like 0.00000634
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|116494920|ref|YP_806654.1|
Sequence length 211
Comment ATP phosphoribosyltransferase catalytic subunit [Lactobacillus casei ATCC 334]
Sequence
MTLTIALTKGRTETQVLPLLAAAGIHCEAIQAKSRRLIFADDPSFHFILVKAPEVLTYLN
HGTVDIGIVGSDILAEQGHRQFDMLDLNTGRCRFILASTADFDPKQTKRKLIATKYPHIA
QQYFQKQGEDVEIIKIEGSVELAPLTGMADAIVDITETGTTLRENHLKVFAELASVSTHL
VVNRLALKQKRTEIYQLIQSLQKVRPQEASL
Download sequence
Identical sequences A0A0R1FCJ1 Q039B0
WP_011674506.1.31893 WP_011674506.1.49750 YP_806654.1.65993 gi|116494920|ref|YP_806654.1| 321967.LSEI_1434

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]