SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|116495894|ref|YP_807628.1| from Lactobacillus casei ATCC 334

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|116495894|ref|YP_807628.1|
Domain Number 1 Region: 36-271
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1e-41
Family Phosphate binding protein-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|116495894|ref|YP_807628.1|
Sequence length 324
Comment nitrate/sulfonate/bicarbonate ABC transporter periplasmic protein [Lactobacillus casei ATCC 334]
Sequence
MKHKKHLWFLVIGLIMWLSVAVYGYTQTTTAASDLETVTIGYQKADPVDIARQHGELIKK
MKAKGYQVVFKEFSDGAALMTALKSGAIDYARVGDTPPVTAKAAGTDIALIAAGATKEYG
SGILVGKNSQITNLKQLKGKTIAYQKGTAAQYLIIQALKKAGLSTNDVKLVNMDQSSASV
AFAKGSVDAWVTWDPYTATAQVNQGAKLLTNGTGLAKNRDFLISTQNYAKTHTALSKLLT
TYINDDMTWANNHHTQLIAMLSKTLKLSDAVIQKMVERRTYAMALVKADSSIVDEENQIA
NTFYQEGVVTEKVDMKTTLVSGSD
Download sequence
Identical sequences A0A0C9Q6I3 A0A0E1PJI1 A0A0E2BNG7 A0A0R1F3E9 A0A1F1JJ97 A0A1S2AX53 C2FB80 K6R8L5 K6RF00 Q035D6 S2QR96 S4ZQS6
gi|523515087|ref|YP_008201171.1| WP_003567455.1.100311 WP_003567455.1.11857 WP_003567455.1.12579 WP_003567455.1.16871 WP_003567455.1.18077 WP_003567455.1.1932 WP_003567455.1.20005 WP_003567455.1.22898 WP_003567455.1.25941 WP_003567455.1.29913 WP_003567455.1.31893 WP_003567455.1.35591 WP_003567455.1.3835 WP_003567455.1.39264 WP_003567455.1.42997 WP_003567455.1.44983 WP_003567455.1.45488 WP_003567455.1.48252 WP_003567455.1.48728 WP_003567455.1.49406 WP_003567455.1.49750 WP_003567455.1.57088 WP_003567455.1.58515 WP_003567455.1.60703 WP_003567455.1.64430 WP_003567455.1.65183 WP_003567455.1.66157 WP_003567455.1.67371 WP_003567455.1.6844 WP_003567455.1.72586 WP_003567455.1.73866 WP_003567455.1.74597 WP_003567455.1.75061 WP_003567455.1.78295 WP_003567455.1.7925 WP_003567455.1.80634 WP_003567455.1.82183 WP_003567455.1.86624 WP_003567455.1.91063 WP_003567455.1.916 WP_003567455.1.91826 WP_003567455.1.94863 WP_003567455.1.96019 WP_003567455.1.98013 WP_003567455.1.9892 YP_807628.1.65993 321967.LSEI_2450 gi|116495894|ref|YP_807628.1| gi|301067451|ref|YP_003789474.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]