SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|148642895|ref|YP_001273408.1| from Methanobrevibacter smithii ATCC 35061

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|148642895|ref|YP_001273408.1|
Domain Number 1 Region: 2-163
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 6.9e-17
Family GHMP Kinase, N-terminal domain 0.0049
Further Details:      
 
Domain Number 2 Region: 232-280
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 0.0000101
Family Homoserine kinase 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|148642895|ref|YP_001273408.1|
Sequence length 289
Comment shikimate kinase [Methanobrevibacter smithii ATCC 35061]
Sequence
MKKSVRSPGSATVINAIATGFGAAFGIGLDIKCCANTQNSSITCSNDVGAPTTLMEICAK
KTFEKYGISSDDFGMNFKTESELPMASGLSSSSALSNAVVSISSKIIAEEFNLMPLDDLE
IINLAIDASLEAKVTITGSFDDATASYFGGVVVTDNKNRKFIIKEKMEEYPVLVYMPNFG
SKSGSSDVGRMKVLSPLVETAFGLARSGDYFKALNLNGLIYANTLGFDSNIAIDALEVGA
IASGLSGTGSSFVAICEDEAIDDIKETWSKYEGRVIETKVDNIGCQFIG
Download sequence
Identical sequences A0A1D2WVX7 A5ULG2 D2ZQ39 R7PUT8
420247.Msm_0835 WP_004033093.1.11702 WP_004033093.1.17842 WP_004033093.1.34893 WP_004033093.1.37628 WP_004033093.1.44750 WP_004033093.1.48459 WP_004033093.1.52714 WP_004033093.1.59899 WP_004033093.1.77301 WP_004033093.1.93728 gi|148642895|ref|YP_001273408.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]