SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|148642908|ref|YP_001273421.1| from Methanobrevibacter smithii ATCC 35061

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|148642908|ref|YP_001273421.1|
Domain Number 1 Region: 1-155
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 0.00000000000358
Family GHMP Kinase, N-terminal domain 0.0056
Further Details:      
 
Weak hits

Sequence:  gi|148642908|ref|YP_001273421.1|
Domain Number - Region: 233-310
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 0.000206
Family Homoserine kinase 0.083
Further Details:      
 
Domain Number - Region: 174-218
Classification Level Classification E-value
Superfamily MM3350-like 0.0497
Family MM3350-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|148642908|ref|YP_001273421.1|
Sequence length 329
Comment GHMP kinase family protein [Methanobrevibacter smithii ATCC 35061]
Sequence
MIIKSPSRLHLTLIDMNGSYGRIDGGIGLTIKDPNFVLYGEPAEKGITVDFKDNTQFNDV
IRNECVSKITSAAQKVIDHFDIDEGFYFRVDKAYLPHSGLGSGTQMGLSTGKLIAEHIGA
YSNGYSLGEIIGRGGTSGIGVFSFDFGGFIVDGGHSLKSKSSFLPSSASQAKPPQLLAHY
DFPDDWEILLVILDSKNTVNGQKEVNIFQDYCPVPKNEVEQTSHIIFMNMIPFLLERDLP
AFGHSIDEIQKRGFKNVEVSLQSQQIRDLTDKLREIGAYGVGMSSFGPTVYSVFDKNNKH
IVEEIKEYVGNRGIVLTTKAQNYGHEIQK
Download sequence
Identical sequences A0A1D2WVU6 A5ULH5
420247.Msm_0848 WP_011954123.1.44750 WP_011954123.1.59899 gi|148642908|ref|YP_001273421.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]