SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|148643410|ref|YP_001273923.1| from Methanobrevibacter smithii ATCC 35061

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|148643410|ref|YP_001273923.1|
Domain Number 1 Region: 98-248
Classification Level Classification E-value
Superfamily Ligand-binding domain in the NO signalling and Golgi transport 2.14e-34
Family MJ1460-like 0.01
Further Details:      
 
Domain Number 2 Region: 19-112
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 8.37e-16
Family ArsR-like transcriptional regulators 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|148643410|ref|YP_001273923.1|
Sequence length 253
Comment ArsR family transcriptional regulator [Methanobrevibacter smithii ATCC 35061]
Sequence
MIKQKPLQIFSKDADMGIDVVKSPVKLTILEMLRSNDMEFDEIVKNTGKSKSTISVHLKS
LREDGIISYRLGESDSRRKIFYLNSKYLGSVEVSKKNEIEETRAEYLIENIVENDGDFTV
LLFHTLRSMLIQEGINIDPVLHSTGIRMGQSLYNKLYDDDLEVFIENIAEFWETKGLGKL
SFKLGQIIKITASDCFECELLPKTGKPACYLDTGIFQALFSEFFGLPVRVIEIQCCSMGD
ENCVFEIEPFKRK
Download sequence
Identical sequences A0A1D2WUE5 A5UMX7
420247.Msm_1350 gi|148643410|ref|YP_001273923.1| WP_011954458.1.44750 WP_011954458.1.59899

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]