SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|148643499|ref|YP_001274012.1| from Methanobrevibacter smithii ATCC 35061

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|148643499|ref|YP_001274012.1|
Domain Number 1 Region: 5-192
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 3.34e-41
Family GHMP Kinase, N-terminal domain 0.00026
Further Details:      
 
Domain Number 2 Region: 177-295
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 1.03e-32
Family Mevalonate kinase 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|148643499|ref|YP_001274012.1|
Sequence length 320
Comment mevalonate kinase [Methanobrevibacter smithii ATCC 35061]
Sequence
MRALASAPAKTILFGEHSVVYDEPAIAGAVNKRAYVEITESKTDKSILKSYDLNFEAELD
TKHKKYNLKRGKPGIIRYILEALNKVHDHSPIVMKLSSNIPIGSGLGSSAAVTVATLAAL
YRFHNIRFNKKSLAHDAHMVEQAVQGIASPLDTLVSTYGGLVYLSRNKKVEHFKVNFNAP
FVVGYTNKHGNTGKMVKDVRLLKNRNPKIINPVISAMGQLTNYAKQAILKRDFDKIGELM
NLNHGFLDVLGVNTLELSRMVYTARECGAIGSKITGAGGGGSIIALCPNSVDEVARGIAA
EDNVLKIRFTRKGVSSRVYK
Download sequence
Identical sequences A0A1D2WU86 A0A2H4U732 A5UN66 B9AE43 D2ZQG1 R7PUK0
gi|148643499|ref|YP_001274012.1| WP_004033293.1.11702 WP_004033293.1.17842 WP_004033293.1.34893 WP_004033293.1.37628 WP_004033293.1.44750 WP_004033293.1.48459 WP_004033293.1.52714 WP_004033293.1.59899 WP_004033293.1.77301 WP_004033293.1.83718 WP_004033293.1.93728 420247.Msm_1439 2004044213

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]