SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|146295899|ref|YP_001179670.1| from Caldicellulosiruptor saccharolyticus DSM 8903

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|146295899|ref|YP_001179670.1|
Domain Number 1 Region: 3-107
Classification Level Classification E-value
Superfamily YheA/YmcA-like 7.59e-30
Family YheA-like 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|146295899|ref|YP_001179670.1|
Sequence length 120
Comment hypothetical protein [Caldicellulosiruptor saccharolyticus DSM 8903]
Sequence
MRNVYDIAYELANALKESNEFKRFKAAKEKIEKDEKLKQMVMDFKKKQLELEQKRLQGQE
VTSSDVYSLQQLYQIISLNPDIEEYLSSEMMLAKILADISKIIAEAVDLKDEMFGLLESK
Download sequence
Identical sequences A4XHU4
gi|146295899|ref|YP_001179670.1| 351627.Csac_0863 WP_011916425.1.70764 WP_011916425.1.85531

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]