SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|146296443|ref|YP_001180214.1| from Caldicellulosiruptor saccharolyticus DSM 8903

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|146296443|ref|YP_001180214.1|
Domain Number 1 Region: 1-190
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.44e-27
Family Nitrogenase iron protein-like 0.0048
Further Details:      
 
Weak hits

Sequence:  gi|146296443|ref|YP_001180214.1|
Domain Number - Region: 406-494
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 0.00392
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|146296443|ref|YP_001180214.1|
Sequence length 499
Comment chromosome partitioning ATPase-like protein [Caldicellulosiruptor saccharolyticus DSM 8903]
Sequence
MGKIISIFSPKGGVGKTTLTLALAEVLQKEGKTLVIEFDFSPGDFATLLDVDKTKNIELA
VVYGLSSAVQKPEGKEYFVVAGGFPETHEKINAEQIKNLLSEARNNFDFILFDIQPGLVE
RSIDVLNNSDKVLVIIENNQYVILRFARIIRYISTRIKDLSKVFIVVNKANPRQKICIPD
EITGEIIPWCGRLHEPWDRKIVFHVERLKQKLLEHRFTDTEKLIEFTNEILRKHNINVST
QYGEVKDGMIYIMTNIQSLDDLLKNRFTDFVTDDISKSRIQVLMCEDKQKIDEAARIQGF
KIVLTSYELERYAYEKGFEYVFAGAIEIPKITHAIEDLISRATAEPERKLIKESKSEQIE
NPEQVVEPEQIEEKPDEDSFSNPVEDSEEELFAQDLKQEVKNIEEKSTATEQTENMQDVE
VFISNLSSAVTQLISTEVSMFLKEHSKNMEDNQKLKQEITKLLEENQKLKERIAELEEKL
KKLNKIKELITSLAGGLDE
Download sequence
Identical sequences A4XJD8
gi|146296443|ref|YP_001180214.1| 351627.Csac_1422 WP_011916959.1.85531

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]