SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|146296620|ref|YP_001180391.1| from Caldicellulosiruptor saccharolyticus DSM 8903

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|146296620|ref|YP_001180391.1|
Domain Number 1 Region: 4-156
Classification Level Classification E-value
Superfamily RNase III domain-like 2.27e-48
Family RNase III catalytic domain-like 0.00017
Further Details:      
 
Domain Number 2 Region: 108-223
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 9.43e-20
Family Double-stranded RNA-binding domain (dsRBD) 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|146296620|ref|YP_001180391.1|
Sequence length 224
Comment ribonuclease III [Caldicellulosiruptor saccharolyticus DSM 8903]
Sequence
MTDIEKKLGYRFKNPNLLKLALTHKSATHDDKSCYERLEFLGDAVLELVVSKYLFEHFPQ
LSEGELTNLRATIVCSETLSKVAETLNLKRYIVFGKNEKKEGFEGNKSIWSDVLEAIFGG
IFLESGFDMAEKIVINLLEPFIKKAAEGKLFYDYKTKLQEFIQREKNVKIKYIDYENFED
NLSRFKSELYIGKNKISEGYGNSKKEAQQEAALNALKKLGVIED
Download sequence
Identical sequences A4XJW5
gi|146296620|ref|YP_001180391.1| 351627.Csac_1608 WP_011917135.1.85531

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]