SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|146297268|ref|YP_001181039.1| from Caldicellulosiruptor saccharolyticus DSM 8903

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|146297268|ref|YP_001181039.1|
Domain Number 1 Region: 82-161
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 6.57e-29
Family Translational machinery components 0.00024
Further Details:      
 
Domain Number 2 Region: 11-78
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 5.13e-23
Family Ribosomal S5 protein, N-terminal domain 0.0000881
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|146297268|ref|YP_001181039.1|
Sequence length 168
Comment 30S ribosomal protein S5 [Caldicellulosiruptor saccharolyticus DSM 8903]
Sequence
MVQKRIDPKELNLKERVVNINRVAKVVKGGKRLKFSAIVVVGDENGHVGAGHGKAAEIPD
AIRKAIEDAKKHLIEVPIVGTTIPHEAIGDFGASKVLIKPAPEGTGVIAGGAVRAVCELA
GIKDIRTKSLGSNNPANVVHATIEALKQLKKPEEVARLRGKTLEEIIK
Download sequence
Identical sequences A4XLR3
351627.Csac_2270 gi|146297268|ref|YP_001181039.1| WP_011917774.1.85531

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]