SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|346722761|ref|YP_001179620.2| from Caldicellulosiruptor saccharolyticus DSM 8903

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|346722761|ref|YP_001179620.2|
Domain Number 1 Region: 66-349
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 3.49e-53
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0000561
Further Details:      
 
Domain Number 2 Region: 351-649
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 7.06e-44
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|346722761|ref|YP_001179620.2|
Sequence length 650
Comment methyl-accepting chemotaxis sensory transducer [Caldicellulosiruptor saccharolyticus DSM 8903]
Sequence
MELSKMKTPRNPAKVSSQVNEANQFQNFNEVQGNNPGVFDATKRKERRDELRRNTIIERL
AATTSETQAAVSQATRNVNELQVAVQEIAASAQEASKAAQESLRAIQEIEKVAKVADERT
GELLNSITNLQALIQSVSDEIEEMIRGIEAAAQVSLESAENVLQLEKQANEIGTTVQAVM
EVADQTNLLALNAAIEAARAGKHGRGFAVVADEVRSLAETTNKAAIEIQSIIEEIQRDVN
VVAEDIRGVGTLVRGEAEKAKGVTEDLRKIEDSINTIVEAMKEIKVLSRNMMNASSEVRG
GSQQIAAAAEEAAAATEESNASLIEQTKALNEINNAMTMLAEMADELKSTSITQKNAEEL
AAASAELAAMVEQSHKASYQISSALEQIMQAAEEQAAACEESQRATENLKNMQKDIVERL
ENTTKLARELQEILSKNKKDVEGLIEGVAQSVEKNKQSLESVRVLEKRIRNIEKIIDTIS
NVTTKIDLLSLNGSIEAARSGKYGKGFAVVAGDIKQLAQQSSDAIGNIKEMVRNINDQVR
IVYEDVETAVKTAIEENEKAQKITFSLERVRGATEKVITEGNQLLASAQDAESALTQIAA
GTVQIAKGAEEASQAAQSAATQAQEQLKAISQIAEATQEIANLAEELKNV
Download sequence
Identical sequences A4XHP4
WP_011916377.1.85531 gi|346722761|ref|YP_001179620.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]