SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|146295269|ref|YP_001179040.1| from Caldicellulosiruptor saccharolyticus DSM 8903

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|146295269|ref|YP_001179040.1|
Domain Number 1 Region: 7-66
Classification Level Classification E-value
Superfamily TTHA1013/TTHA0281-like 8.63e-19
Family TTHA0281-like 0.021
Further Details:      
 
Domain Number 2 Region: 71-111
Classification Level Classification E-value
Superfamily Ribbon-helix-helix 0.00000000245
Family Arc/Mnt-like phage repressors 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|146295269|ref|YP_001179040.1|
Sequence length 161
Comment hypothetical protein [Caldicellulosiruptor saccharolyticus DSM 8903]
Sequence
MDYKVEIIKLSEEDGGGYLAIVPKLPGCMSDGSTPHEALENVQDAIKCWIETAREKGRQI
PPPDEYKEEEYSGRLVLRIPKSLHKHLAEEAKKEGVSLNSFIQHLISYALGCRENKTQEL
AIPYIPGSTLKGSIRKLFIKKEHYNPPVLQLGNFQQKDRSD
Download sequence
Identical sequences A4XG14
gi|146295269|ref|YP_001179040.1| 351627.Csac_0201 WP_011915814.1.85531

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]