SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|146295474|ref|YP_001179245.1| from Caldicellulosiruptor saccharolyticus DSM 8903

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|146295474|ref|YP_001179245.1|
Domain Number 1 Region: 150-423
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 1.05e-60
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0000311
Further Details:      
 
Weak hits

Sequence:  gi|146295474|ref|YP_001179245.1|
Domain Number - Region: 66-160
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0022
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|146295474|ref|YP_001179245.1|
Sequence length 425
Comment methyl-accepting chemotaxis sensory transducer [Caldicellulosiruptor saccharolyticus DSM 8903]
Sequence
MPPKSNGNESVKKGVISLTYVALAFIIILDILLGIIMPTGNLKLYSIVVATITFILTLAI
TAFMIRYEMNKMITKLENTLEVIKNGDYSKLILSKEFGNIQRVASSVNIVLSDIKLLIEE
FFNLSNAIVGASKKVTKTSEDAAAAIEEIAKTVEEIAKGASQQAEEAQHGVLLVNNLSEQ
LNAVSESYNAVIEETNKIETLNKDGIEKMNDLREKSEVALTTAEKVIETIMTFVERIKTI
SNFVEVINTIAEQTNLLALNAAIEAARAGEAGKGFAVVADEVRKLADQSKKAADEINSIV
DVILSETENTIKIIDEIKAAALGQRDAVIESQHSFGKISDEITAIVEKTQIVKEALNRME
EARNAVIRAIESISSVSQETAAASQEVAATVENQLNSINEMKYSAQSLQKLVDELDKKLK
KYKIR
Download sequence
Identical sequences A4XGL9
351627.Csac_0415 gi|146295474|ref|YP_001179245.1| WP_011916008.1.85531

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]