SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|146297484|ref|YP_001181255.1| from Caldicellulosiruptor saccharolyticus DSM 8903

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|146297484|ref|YP_001181255.1|
Domain Number 1 Region: 59-371
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 1.18e-30
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.00034
Further Details:      
 
Domain Number 2 Region: 400-510
Classification Level Classification E-value
Superfamily Sensory domain-like 0.0000000000000916
Family Sensory domain of two-component sensor kinase 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|146297484|ref|YP_001181255.1|
Sequence length 511
Comment methyl-accepting chemotaxis sensory transducer [Caldicellulosiruptor saccharolyticus DSM 8903]
Sequence
MQVVLTILGALVLSTVFSILILKISVDKTLSILQGKNNLNAIEKLFLTPIKDWAASFQGF
LSDIFKEIDLAYNKILSVAYDIESSAEKNQQQSNLVLSNSKDIQNSISELLIGLKLVLEH
IESAYENISSLEEFMAHFKEKNQNIQEDIQKLLAEVSTDLENMVSENTAYTHKMADQITK
LKAVFKKVEDFLGTIVKISEQINILALNASIESAKLESVLGENFKTGFHVIADQIRRLSN
DTKSTADEIGDFIIEISGIVDGISSLSEKSKDIISRQVEYGKTTFEKLNQVSQLVAYINK
KISQASEKLSVQYSIVNDLKHYVTRLENSYIAVDSSTNKILSSVEVSKKTAERLMRLMNR
LVDMCREFESVRNDISAKITKRVEIEVNQQRIKEAIEIIENELIPQLVSSWQKELNHKEV
IDQSLQKFSNIFEALWTNNPDGTFIYSNPPEGIENAKVREWFTKAMAGHTYVSSAYISAI
TRNYCITVSMPVYDGIGKLLGVLGADIKLSM
Download sequence
Identical sequences A4XMC9
WP_011917984.1.85531 gi|146297484|ref|YP_001181255.1| 351627.Csac_2487

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]