SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|120434694|ref|YP_860381.1| from Gramella forsetii KT0803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|120434694|ref|YP_860381.1|
Domain Number 1 Region: 123-280
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 2.62e-45
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.00025
Further Details:      
 
Domain Number 2 Region: 398-558
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 4.32e-30
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.00078
Further Details:      
 
Domain Number 3 Region: 254-278,307-408
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 9.98e-25
Family Duplicated SiR/NiR-like domains 1 and 3 0.0073
Further Details:      
 
Domain Number 4 Region: 21-122
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 4.91e-24
Family Duplicated SiR/NiR-like domains 1 and 3 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|120434694|ref|YP_860381.1|
Sequence length 697
Comment ferredoxin-sulfite reductase [Gramella forsetii KT0803]
Sequence
MQSFRTEIENPVVEKDIIDLEKKIRLFREGKADEEKFRSLRLARGVYGQRQAGVQMVRIK
LPFGKVTSEQLHRIANVSDEYSKGRLHITTRQDIQIHYVSLDRTPELWAQLEKDDVTLRE
ACGNTVRNITASPTAGIDPKEPFDVSPYADAAFKFFLRNPICQEMGRKFKMSFSSSEEDT
ALSYIHDLGFIAKLKDGKRGFKVMLGGGLGSQPRHADELYDFLPAEEIIPLTEGVLRVFD
RHGERAKRLKARMKFLVKDIGKEAFMELVEEEKTALSQKQPEFEIEKFEAAPPLQDVEVP
AVEIENQKDFETWKNTNVFAQKQEGLFAVGIRVPLGDFYTGGAREVADLVKKYAGNEIRL
TLRQDILIRHIREEFLPFFYAELKKLGYAETGYNKTVDITACPGTDTCNLGIASSTGIAD
VLEDVLKEEYPQFINGKDITIKISGCMNACGQHNMAEIGFQGMSIKVGKTVAPALQVLLG
GGTLGDGQGRFADKVVKVPSKRGPEALRVLLNDFEANSETDEKFAEYYDRKEKTYFYDLL
KDLADTSNLSENDFVDWGHESPYIKAVGVGECAGVVIDLIATLLFESEEKIDNAKSALER
KDWADSIYHSYTSIVNSAKALLIAEDVKTNTQAGIIAQFDELFVETGKIELATSFKEFVY
QLNENEPSEAFANKYLEDAHLFLKRVDAFRTKEVQNV
Download sequence
Identical sequences A0LY68
WP_011708251.1.75286 411154.GFO_0327 gi|120434694|ref|YP_860381.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]