SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|120435107|ref|YP_860793.1| from Gramella forsetii KT0803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|120435107|ref|YP_860793.1|
Domain Number 1 Region: 15-267
Classification Level Classification E-value
Superfamily PLP-binding barrel 9.74e-66
Family Alanine racemase-like, N-terminal domain 0.0000741
Further Details:      
 
Domain Number 2 Region: 245-396
Classification Level Classification E-value
Superfamily Alanine racemase C-terminal domain-like 1.28e-45
Family Eukaryotic ODC-like 0.0000949
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|120435107|ref|YP_860793.1|
Sequence length 411
Comment diaminopimelate decarboxylase [Gramella forsetii KT0803]
Sequence
MTQKDLLSITKEFSSPVYVYDADKIISQYQRLTDAFKVNELRIHYAVKALSNISILKLLG
SLGCGLDTVSVQEVRLGLKAGVDPSKIIYTPNGVSLEEIEEVVQLGVQINIDNLSVLEQF
GTKHPKIPVCIRINPHVMAGGNSKISVGHIDSKFGISIHQMPHLLRIVENTEMHINGIHM
HTGSDILDIGVFLYASEILFEAAKNFKELEFIDFGSGFKVPYREGDIETDIEDLGVQLTQ
KFKKFCKEYGRELALAFEPGKFLVSESGKFLAKVNVIKQTTSTVFAGIDSGFNHLIRPMF
YGSHHDITNISNPNAKPRFYSVVGYICETDTFGNNRRISEIREGDILSFSNAGAYCFSMA
SNFNSRYRPPEVMWYNGKAHLIRERETFEDLTRHQVEINFDSSPKQLVDKE
Download sequence
Identical sequences A0LZD1
411154.GFO_0749 WP_011708663.1.75286 gi|120435107|ref|YP_860793.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]