SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|120437944|ref|YP_863630.1| from Gramella forsetii KT0803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|120437944|ref|YP_863630.1|
Domain Number 1 Region: 42-314
Classification Level Classification E-value
Superfamily PLP-binding barrel 5.05e-41
Family Alanine racemase-like, N-terminal domain 0.0039
Further Details:      
 
Domain Number 2 Region: 284-445
Classification Level Classification E-value
Superfamily Alanine racemase C-terminal domain-like 3.35e-20
Family Eukaryotic ODC-like 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|120437944|ref|YP_863630.1|
Sequence length 467
Comment arginine decarboxylase [Gramella forsetii KT0803]
Sequence
MNTKYSDLIDQTYYFPQEEFNLDGAELKFHDIDLMELVRTYGAPLKFTYLPKISQNINRA
KDWFKSAIEKHDYKGSYNYCYCTKSSHFEHVLNEALKNDIHIETSSAFDINIVEKLKKAG
KISDDRWVICNGFKRDQYIENISRLLNGGHKNCLPIIDNYEELDLLSEKIDDKFQVGIRI
ASEEEPKFEFYTSRLGIGYKNIVPFYNKQIKENDQVELKMLHFFINTGIRDTAYYWNELN
KCLKVYIALKKVAPHLDSLNIGGGFPIKNSLAFEYDYAYMVDEIINHIKLTCDDAEVDVP
NIFTEFGSFTVGESGGAIYEVLYQKQQNDREKWNMINSSFITTLPDTWAISKKFVMLAVN
RWNDEYERVLLGGLTCDSDDYYNSEQHTNAIYLPKFKKEKPLYIGFFNTGAYQDTIGGFG
GLQHCLIPQPKHILINKDENGQLNTRLFSEEQNHEDMLNILGYDRNK
Download sequence
Identical sequences A0M7G8
WP_011711464.1.75286 gi|120437944|ref|YP_863630.1| 411154.GFO_3625

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]