SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|152993755|ref|YP_001359476.1| from Sulfurovum sp. NBC37-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|152993755|ref|YP_001359476.1|
Domain Number 1 Region: 49-517
Classification Level Classification E-value
Superfamily Nitrous oxide reductase, N-terminal domain 1.7e-82
Family Nitrous oxide reductase, N-terminal domain 0.0000016
Further Details:      
 
Domain Number 2 Region: 478-498,534-654
Classification Level Classification E-value
Superfamily Cupredoxins 8.51e-26
Family Nitrosocyanin 0.0011
Further Details:      
 
Domain Number 3 Region: 765-861
Classification Level Classification E-value
Superfamily Cytochrome c 0.00000000000000304
Family monodomain cytochrome c 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|152993755|ref|YP_001359476.1|
Sequence length 866
Comment nitrous-oxide reductase NosZ [Sulfurovum sp. NBC37-1]
Sequence
MSYKLSKLTSLFLGSALSVSTLFGASALDNVMKERGLTQADLLAAAKTYTPSGGRDKYIV
FSSGGQSGQIMVYGVPSMRILKYIGVFTPEPWQGWGYDDDTKKVLAQGNIRGKKITWGDT
HHPALSETNGRYDGKWLVINDKANPRLAVIDLKDFVTKQIVVNPVFKSDHGGAFFTPNSE
HILEACQYGAPLDNNYHPIEEYKETYRGGVTVWKFDPKIGRIDPKKSFTIEMPPYMQDLS
DAGKEASFGWGFTNSFNSELYTGGIEKGLPPFEAGMSRNDTDFLHVYNWKKLAELAKDPK
NVKMVNGTRVIPMEVAIKNDALFLIPEPKSPHGVDVSPDGKSIVVCGKLDTHATVYDFDK
IQDAIKHKAYVGKDPYGIPILDLKKTMHCQAELGLGPLHNQYGKNWKDGEIYTSLYVDSQ
VVKWNYKTCKVEDRQNVNYNIGHLCGMEGKTEDPQGDYIIALNKLAIDRFNEIGPLHPQN
HQLIDIRGKKMQLLYDMPVPLGEPHQAVAIRASKLKTEVRYKMGTNAFTGKVHEGKTLAG
QEKIVRKGNHVYVYGTVVRSHINPEHVTVNKGDTVTFYLTNLERAEDETHGFTVDTYNVH
TSLEPGKTVAVTFKADLEGVFPYYCTEFCSALHLEMMGYLLVKDPNKKYTAAKKLKMAAM
SPEQLKKEYDQTVAVNNATDKVIQSVVKFLKENHYEKFPTIKALVTDALDQYGKIPEQKK
KADEAVKAGNLDKAILFENMIWQYMVKTADVGIRAKDLLVKKVAKPMSPAAKRGEAAYLE
GGCNGCHVIGKVSSGPDLTGVLQRHENGEAWAAQWIMHPEKMYDDDYIKSMINYFNLRMP
NQGMTEEQTKDIIEYLKWIDENANLF
Download sequence
Identical sequences A6QCB0
WP_012083949.1.96465 gi|152993755|ref|YP_001359476.1| 387093.SUN_2179

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]