SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|152993908|ref|YP_001359629.1| from Sulfurovum sp. NBC37-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|152993908|ref|YP_001359629.1|
Domain Number 1 Region: 83-175
Classification Level Classification E-value
Superfamily Ribosomal protein L6 2.67e-34
Family Ribosomal protein L6 0.0000639
Further Details:      
 
Domain Number 2 Region: 2-82
Classification Level Classification E-value
Superfamily Ribosomal protein L6 1.1e-16
Family Ribosomal protein L6 0.00092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|152993908|ref|YP_001359629.1|
Sequence length 178
Comment 50S ribosomal protein L6 [Sulfurovum sp. NBC37-1]
Sequence
MSRIGKRPVTVPSGIEVSLDGTTLVAKKGNLEKRLETHGRVGINIDGSEVTFTRVGDEKQ
DAAFWGTYRALFNNIMVGLDKGYSKSLEINGVGYRAAVEGKTLKLQLGFSHDVNFEIPEG
LDIKVDKNIITVSGTDKQAVGQAAAEIRAYRPPEPYKGKGVKYTDEVIIRKAGKAAGK
Download sequence
Identical sequences A0A0F6Z409 A6QCR3
gi|152993908|ref|YP_001359629.1| 387093.SUN_2336 WP_012084113.1.87398 WP_012084113.1.96465

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]