SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|138894324|ref|YP_001124777.1| from Geobacillus thermodenitrificans NG80-2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|138894324|ref|YP_001124777.1|
Domain Number - Region: 43-107
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain III 0.00641
Family DNA repair protein MutS, domain III 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|138894324|ref|YP_001124777.1|
Sequence length 135
Comment hypothetical protein GTNG_0652 [Geobacillus thermodenitrificans NG80-2]
Sequence
MSGPSLRKLEAHRSIHHGAFVEAKRLTELLETLYTDGRYEHAAEVADALAEHWEKRIIAH
AEAEEEGFYREKAEERKELSETIAQLKRDHDMMRTLIAEIRQRLSEQIDREVLTRFHALL
HINRIHSADEEALLF
Download sequence
Identical sequences A0A0Q0UY85 A0A2D1K411 A4IL28
gi|138894324|ref|YP_001124777.1| WP_011886917.1.10634 WP_011886917.1.10946 WP_011886917.1.41580 WP_011886917.1.47684 WP_011886917.1.88187 420246.GTNG_0652

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]