SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|138894648|ref|YP_001125101.1| from Geobacillus thermodenitrificans NG80-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|138894648|ref|YP_001125101.1|
Domain Number 1 Region: 190-587
Classification Level Classification E-value
Superfamily beta-lactamase/transpeptidase-like 1.18e-95
Family beta-Lactamase/D-ala carboxypeptidase 0.0000034
Further Details:      
 
Domain Number 2 Region: 57-239
Classification Level Classification E-value
Superfamily Penicillin binding protein dimerisation domain 4.84e-45
Family Penicillin binding protein dimerisation domain 0.0001
Further Details:      
 
Domain Number 3 Region: 657-709
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.00000000000183
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0074
Further Details:      
 
Domain Number 4 Region: 600-653
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.00000000000863
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|138894648|ref|YP_001125101.1|
Sequence length 736
Comment high molecular weight penicillin binding protein [Geobacillus thermodenitrificans NG80-2]
Sequence
MEMKKHSNTHRGAGILFIVFSLLFFLLFARFIQLQWTGKADGHVLAAKAEQQHKQKRVIE
AKRGTIFDRNGTILAQDVPSYTVVAILDPEMTTNPERPRHVVDPETTAKKLAPLLGMDVK
DMERILTKKAKQVEFGSYGRNISFELKRKIEALDLPGIAFIRDTNRFYPNGTFASHVIGY
AQKNAENETVGKMGVEKWLDRYLRETDGYVSFAGDVNGFRLPEAKERIVKPDNGANVYLT
IDGKIQTFLEDAMNNVEKQYKPKKMIGIVADPKTGKILAMATRPSFDPNKRDITNFLNDA
ISYPYEPGSTMKVFTLAAAINEGVYNGKETFRSGAYKVGPNTVRDHNDVGWGTITFDEGV
QRSSNVAFSILVKEKLGEDRFLQYLHRFRFDQKTGIDLPNESVGQIRYRYPIERITTGFG
QGTSVTPIQQIQAATAIANDGKMMKPYIIEKVVDPDNGKVVLDHEPTVAGEPITAETARQ
VREILETVVSSEHGTGRPYQIDGYRVAGKTGTAQIPSAAGGYMTGRENYIFSFLGMAPAD
DPRLIMYVAVQQPRLDVTETGAAPVSQIFTTVMKSSLQYLHIEPVEKKQTETKKAERRAL
DSLIGQTAVSAAEQLKEKGYVPVVIGNGKNVERQLPSGGERVLPGERVVLKTDGSATMPD
LRGFSLRDAMKVANVLELRPSTKGTGYVVSQSIRPGAEVRKGDYLIVELASPRQWEETMA
KKEKEAAERKDNKPHE
Download sequence
Identical sequences A0A2D1K331 A4IM02
420246.GTNG_0978 WP_011887097.1.10634 WP_011887097.1.10946 WP_011887097.1.41580 WP_011887097.1.90235 gi|138894648|ref|YP_001125101.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]