SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|138894649|ref|YP_001125102.1| from Geobacillus thermodenitrificans NG80-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|138894649|ref|YP_001125102.1|
Domain Number 1 Region: 170-568
Classification Level Classification E-value
Superfamily beta-lactamase/transpeptidase-like 5.81e-105
Family beta-Lactamase/D-ala carboxypeptidase 0.0000227
Further Details:      
 
Domain Number 2 Region: 52-219
Classification Level Classification E-value
Superfamily Penicillin binding protein dimerisation domain 2.62e-46
Family Penicillin binding protein dimerisation domain 0.00095
Further Details:      
 
Domain Number 3 Region: 584-635
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0000000000353
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|138894649|ref|YP_001125102.1|
Sequence length 644
Comment stage V sporulation protein D [Geobacillus thermodenitrificans NG80-2]
Sequence
MRVSYVTVRKRLTIVFLIGIFIFAIIDLRLGYVQFWLSDMLTERAKGLWGRNIPFEPKRG
EILDRNGVPLATNMSAPTVYVIPRQVKNPAEAAEKLSVVLGASVESIYKQITQKTSIVRL
KEGRKISDEKAASVRALDLDGIYIAEDTKRYYPFGSYLSHVLGFSGIDNQGLTGLELYYD
KELSGERGSVQFYSDAKGRRMPGIADDYTPPTDGLDLVLTIDSRIQTIIERELDIAEAKY
NPDGIIAIAMNPNTGEILAMASRPTFDPANYRDVPPEIYNRNLPIWSTYEPGSTFKIITL
AAALEEGKVNLLKDHFFDPGYAKVAGATLRCWKKGGHGEQTFLEVVQNSCNPGFVELGER
LGKETLFKYIKQFGFGEKTGIDLQGEGTGILFDLKRVGPVELATTAFGQGVSVTPIQQVA
AVSAAVNGGVLYTPYIAKEWIDPETGEIVRRNTPKAKRRVISEETSKQVRYALESVVAQG
TGKKAYVEGYRVGGKTGTAQKAQGGRYLQNNHIVSFIGFAPADDPQLVVYVAVDNPKGTV
QFGGTVAAPIVGKVMEDSLRVMNVKPRKDQLAKERDWNEPKVLEVPNLIGLTKKDLQEQL
FDLKLDVSGEGDVVVEQSPEPGAKVKEGSTIRIYLAKNETAEEQ
Download sequence
Identical sequences A0A0Q0Z1C4 A0A1W6VQ22 A0A2D1K352 A4IM03
gi|138894649|ref|YP_001125102.1| 420246.GTNG_0979 WP_008878692.1.10634 WP_008878692.1.10946 WP_008878692.1.41580 WP_008878692.1.47684 WP_008878692.1.76507 WP_008878692.1.88187 WP_008878692.1.90235

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]