SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|138894697|ref|YP_001125150.1| from Geobacillus thermodenitrificans NG80-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|138894697|ref|YP_001125150.1|
Domain Number 1 Region: 7-269
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.78e-87
Family Protein kinases, catalytic subunit 0.00000116
Further Details:      
 
Domain Number 2 Region: 510-571
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0000445
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.013
Further Details:      
 
Weak hits

Sequence:  gi|138894697|ref|YP_001125150.1|
Domain Number - Region: 374-434
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.000876
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|138894697|ref|YP_001125150.1|
Sequence length 665
Comment Pkn2 protein [Geobacillus thermodenitrificans NG80-2]
Sequence
MLIGKRLNDRYKIISLIGGGGMANVYLARDIILERDVAVKVLRLDFANDEQFIKRFRREA
QAATSLNHEHIVSIYDIGEEEGVYYIVMEYVRGATLKQYIQQYAPLPVEQALRIMDQLTS
AIAHAHENGIIHRDIKPQNILLDEDGNVKVTDFGIAVAMSGTTITQTNSVLGSVHYLSPE
QARGGIATEKSDIYSLGVVMFELVTGRLPFSGESAVSIVLKHLQEETPSPKDWNPEIPQS
VENIILKAMAKDPFYRYPSAQEMNEDIRTALDPRRRNEAKFTIPDDDEATKVIPVMKRPE
SAALEQETIIDEEKVSESAKTADEPKQKPKPKPKPKSKRKRMWITWLAAALLLLGVVGVS
ALTWIPDLVFPKDVTIPDVTNKEYDEAVEELSALGLEIKDTIDVEDDTIEEGKVVRTDPE
AGMTVKPGAGVVIYKSVGKKKIEFPSFIGDEISVAEEELRAEGFTRITRNGRYSDKPEGT
ILDQYPYAGDEVVPDETEVIFTVSLGPEKVRLKDLTGYTEKSVRDYVEDQGLRIEVTYEH
SDDVPEGLVISQTPAAGEQVEKGKTITVVISRGPEPKPSKTVVKEITVPYEPAEEGQIVK
AQLYIQDANHNMTTPYKTYQLTQSVTETVEFEIPYGETAYYRVIVNNVVKDEGTIPYPEN
GGKKE
Download sequence
Identical sequences A0A0Q0ZSI7 A4IM51
420246.GTNG_1029 gi|138894697|ref|YP_001125150.1| WP_008878634.1.10634 WP_008878634.1.10946 WP_008878634.1.76507

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]