SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|138894761|ref|YP_001125214.1| from Geobacillus thermodenitrificans NG80-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|138894761|ref|YP_001125214.1|
Domain Number 1 Region: 161-346
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 1.96e-62
Family Methylesterase CheB, C-terminal domain 0.0000151
Further Details:      
 
Domain Number 2 Region: 1-109
Classification Level Classification E-value
Superfamily CheY-like 4.84e-31
Family CheY-related 0.00039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|138894761|ref|YP_001125214.1|
Sequence length 348
Comment chemotaxis-specific methylesterase [Geobacillus thermodenitrificans NG80-2]
Sequence
MKTIKVLVVDDSAFMRKWISDFLSEHPRLEVIGTARNGQEALEKIAVLHPDVVTLDVEMP
VMDGLETLRHIMEKKPLPVVMVSSTTKEGAENTVTAMQYGAVDFVAKPSGSLSLDLYKVR
DELVRKVLHASEANIRALTVRRSKVGPWRSLDKTAHVGKAIVAIGTSTGGPRALETVLTQ
LPPDLAAPVVIVQHMPKGFTKSLANRLDALSAITVKEAEDGEVLRNGTAYIAPGGVHLAV
REENGVLKAHFDASPPRAGHRPAVDVLFESLAAIHHCRKVVVIMTGMGADGTKGLKKLKE
SGDVEAIAEARETAVIYGMPRAAIETGVIDVITPLDGIAAAIVQSIGE
Download sequence
Identical sequences A0A0Q0ZSP5 A0A1W6VRG3 A4IMB5
gi|138894761|ref|YP_001125214.1| 420246.GTNG_1095 WP_008878567.1.10634 WP_008878567.1.10946 WP_008878567.1.76507 WP_008878567.1.90235

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]