SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|138894932|ref|YP_001125385.1| from Geobacillus thermodenitrificans NG80-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|138894932|ref|YP_001125385.1|
Domain Number 1 Region: 146-346
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 7.33e-63
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.000000406
Further Details:      
 
Domain Number 2 Region: 431-563
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 1.26e-35
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.00000657
Further Details:      
 
Domain Number 3 Region: 13-145
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 6.54e-33
Family Duplicated SiR/NiR-like domains 1 and 3 0.0025
Further Details:      
 
Domain Number 4 Region: 348-424
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 4.58e-23
Family Duplicated SiR/NiR-like domains 1 and 3 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|138894932|ref|YP_001125385.1|
Sequence length 573
Comment sulfite reductase subunit beta [Geobacillus thermodenitrificans NG80-2]
Sequence
MAKVVLKAPDGPPSDVERIKRESRYLRGTLAETMEDPISAGIPDDDNRLMKFHGSYLQDD
RDVRTERQKQKLEPAYQFMIRVRTPGGVATPEQWLVMDEIARKYANGTLKLTTRQAFQLH
GVLKWNVKKTMQAINGALMTTLAACGDVNRNVMCNPNPYQSEVHAEVYEWAKLLSDHLLP
KTRAYYEIWLDDEKVAGTPQVDGEEEPIYGPTYLPRKFKIGIAVPPSNDVDVFSQDIGLI
AIVEDGKLAGFNVAIGGGMGMTHGDKTTYPQLAKVIGFCTPDQVVEVAEKIMTVQRDYGN
RSVRKNARFKYTIDRLGLEVVKEEIERRLGWKLGEARPYHFEHNGDRYGWVEGVNGTWHF
TLYVEGGRVKDDDDYKLMTGLREIAKVHTGDFRLTANQNLVIANVTSEKKAEIEALIAKY
GLTDGKRYTALRRNSLACVALPTCGLAMAEAERYLPKLLDKIEEIIDENGLRDEEITIRM
TGCPNGCARHVLAEIAFVGKAVGKYNMYLGAAFNGTRLGKLYRENIGEEEILRELRVLLA
RYAKERLDGEHFGDFVIRAGIVKEVTDGTNFHD
Download sequence
Identical sequences A0A0N8W2Y7 A0A2D1K2A8 A4IMT6
420246.GTNG_1270 gi|138894932|ref|YP_001125385.1| WP_008879451.1.10634 WP_008879451.1.10946 WP_008879451.1.47684 WP_008879451.1.76507 WP_008879451.1.88187

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]