SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|138896140|ref|YP_001126593.1| from Geobacillus thermodenitrificans NG80-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|138896140|ref|YP_001126593.1|
Domain Number 1 Region: 3-159,288-447
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 2.87e-103
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00000000766
Further Details:      
 
Domain Number 2 Region: 156-283
Classification Level Classification E-value
Superfamily GAD domain-like 6.87e-42
Family GAD domain 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|138896140|ref|YP_001126593.1|
Sequence length 453
Comment aspartyl-tRNA synthetase [Geobacillus thermodenitrificans NG80-2]
Sequence
MFQTLELRHKVAKAVRNFLDGERFLEVETPMLTKSTPEGARDYLVPSRVHPGEFYALPQS
PQIFKQLLMVGGFERYYQITRCFRDEDLRADRQPEFTQIDIEMSFVDQEDIIDLTERMMA
AVVKATKGIDIPRPFPRITYDEAMSRYGSDKPDVRFGLELVDVSEAVRGSAFQVFARAVE
QGGQVKAINVKGAASRYSRKDIDALAEFAGRYGAKGLAWLKVEGGELKGPIAKFFVDDEQ
TALRQLLAAEDGDLLLFVADEKAIVAAALGALRLKLGKELGLIDETKLAFLWVTDWPLLE
YDEEEGRYYAAHHPFTMPVRDDIPLLETNPGAVRAQAYDLVLNGYELGGGSLRIFERDVQ
EKMFRALGFDQEEARRQFGFLLEAFEYGTPPHGGIALGLDRLVMLLAGRTNLRDTIAFPK
TASASCLLTEAPGPVSEKQLKELHLAVVLPDQQ
Download sequence
Identical sequences A4IR94
420246.GTNG_2503 gi|138896140|ref|YP_001126593.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]