SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|138896213|ref|YP_001126666.1| from Geobacillus thermodenitrificans NG80-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|138896213|ref|YP_001126666.1|
Domain Number 1 Region: 1-158
Classification Level Classification E-value
Superfamily Glutamyl tRNA-reductase catalytic, N-terminal domain 9.94e-49
Family Glutamyl tRNA-reductase catalytic, N-terminal domain 0.00022
Further Details:      
 
Domain Number 2 Region: 163-315
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 1e-38
Family Aminoacid dehydrogenase-like, C-terminal domain 0.00036
Further Details:      
 
Domain Number 3 Region: 318-420
Classification Level Classification E-value
Superfamily Glutamyl tRNA-reductase dimerization domain 1.24e-17
Family Glutamyl tRNA-reductase dimerization domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|138896213|ref|YP_001126666.1|
Sequence length 455
Comment glutamyl-tRNA reductase [Geobacillus thermodenitrificans NG80-2]
Sequence
MQIIVVGVNYKTAPVEIREKLAFGEAELGEAMKQLAKQKSILENVIVSTCNRTEIYAVVD
QLHTGRYYIKAFLAEWFDIEAEAIAPYLRVLEGEAAAGHLFRVAAGLDSMVLGETQILGQ
VKGSYLLAQEIGTSGTILNHLFKQAVTFAKRAHSETGIGAHAVSVSYAAVELAKKIFGHL
NGKHVLIIGAGKMGTLAAQNLYGNGVGKVTVVNRTLEKAKQLAAQFDGEAKSLGELSCAL
LEADIVISSTGAKGYMLTKEEMAPLEKMRKGRPLFMVDIAVPRDLDPALAELETVFLYDI
DDLQDVVAANLAERQKAAALIEEMIEGELVAFGQWLQTLGVVPVIAALREKALAIQAETM
KSLERKLPHLSERDRKVLNKHTKSIINQLLRDPILQVKELAAGPNADEALQLFMKIFNIE
DAVKAEQRSAQRAEVQLRDEQQAEAVRAARPSWQL
Download sequence
Identical sequences A0A0Q0USY5 A0A1W6VUD8 A0A2D1K808 A4IRG7
gi|138896213|ref|YP_001126666.1| 420246.GTNG_2576 WP_011887920.1.10634 WP_011887920.1.10946 WP_011887920.1.41580 WP_011887920.1.47684 WP_011887920.1.88187 WP_011887920.1.90235

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]