SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|138894181|ref|YP_001124634.1| from Geobacillus thermodenitrificans NG80-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|138894181|ref|YP_001124634.1|
Domain Number 1 Region: 204-340
Classification Level Classification E-value
Superfamily CBS-domain pair 1.77e-30
Family CBS-domain pair 0.0025
Further Details:      
 
Domain Number 2 Region: 356-438
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 3.82e-20
Family CorC/HlyC domain-like 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|138894181|ref|YP_001124634.1|
Sequence length 450
Comment magnesium and cobalt efflux protein CorC [Geobacillus thermodenitrificans NG80-2]
Sequence
MDIASLLLVALLIACTAFFVASEFAIVKVRSSRIDQLVNEGNKQAVAAKKVISNLDGYLS
ANQLGITLTSLGLGWLGEPTVARMLLPLFERLHLSESVSHFLAFIISFSLITFLHVVVGE
LAPKTFAIHKAEAITLWTAKPLIWFYKIMYPFIWTLNNSARLVTRLFGLRPVAEHEIAHS
EEELRLILSESYKSGEINQSEYRYVNNIFRFDDRVAKEIMVPRKEIVALDINKSVKENLA
IIQEEKYTRYPVIDGDKDHVLGLINVKEVFTDFVANPSNEKQMKDYIRPIIQVIESIAIH
DLLVKMQKERIHMAILVDEYGGTSGLVTVEDILEEIVGEIQDEFDIDETPLIQKIDDRFI
LDGKVLIGEVNDLLGLELDDDDVDTIGGWVLTKYYDIQTGDSVEIDGYLFTVKEMDGHHV
KTLEVVKKEPKPDEEESEPADAGEEEQLRL
Download sequence
Identical sequences A0A2D1K4J3 A4IKN5
WP_011886828.1.10634 WP_011886828.1.10946 WP_011886828.1.41580 WP_011886828.1.47684 WP_011886828.1.88187 WP_011886828.1.90235 gi|138894181|ref|YP_001124634.1| 420246.GTNG_0507

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]