SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|138894214|ref|YP_001124667.1| from Geobacillus thermodenitrificans NG80-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|138894214|ref|YP_001124667.1|
Domain Number 1 Region: 190-332
Classification Level Classification E-value
Superfamily CBS-domain pair 2.91e-34
Family CBS-domain pair 0.0017
Further Details:      
 
Domain Number 2 Region: 328-408
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 5.45e-21
Family CorC/HlyC domain-like 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|138894214|ref|YP_001124667.1|
Sequence length 416
Comment hemolysin-like protein [Geobacillus thermodenitrificans NG80-2]
Sequence
MFGWFFLFLLVNALFASAEAAFSSASKARLKHYAEEHPHNQRLQAVIEQLDRALLALAIA
NRLTSITAVALFIYIAASLLGEQTGLFVSIAVMTILSIVFSDILPKSMAKEQAETLAIRY
VSLAYGLMKLMAPVTALFQAMRERISRRFTNGAAAPAVTEEDIKVMVELSEEEGVIDNKE
KELIQRSLDFDEILVEEIFTPRADMVAVEVNQPIEEIRDVFLEERYSRIPVYEGDIDNVI
GILSESDFFSELVQNHDVRIRELLRQPLFVVESMKVSDLLPELQKSKVHMAIVVDEFGGT
AGLITLEDIIEQIVGEIWDEHDEAVKTVRQIDEHSFEFSAELPLDEFCEVMKIDVPESES
RTLGGWIFEMFERIPAVGETLQYGPLTLTVRQVDNRRIRKVLVSLNQPLAGQAGGM
Download sequence
Identical sequences A4IKR8
gi|138894214|ref|YP_001124667.1| 420246.GTNG_0540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]