SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|148652076|ref|YP_001279169.1| from Psychrobacter sp. PRwf-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|148652076|ref|YP_001279169.1|
Domain Number 1 Region: 106-233
Classification Level Classification E-value
Superfamily alpha-helical ferredoxin 5.06e-37
Family Fumarate reductase/Succinate dehydogenase iron-sulfur protein, C-terminal domain 0.00000246
Further Details:      
 
Domain Number 2 Region: 6-105
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 5.71e-28
Family 2Fe-2S ferredoxin domains from multidomain proteins 0.0000502
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|148652076|ref|YP_001279169.1|
Sequence length 236
Comment succinate dehydrogenase iron-sulfur subunit [Psychrobacter sp. PRwf-1]
Sequence
MSRGTRTIEIYRYDPDKDAAPYMQTYTIELLDSDRMLLDVLLRLKKQDESITFRRSCREG
ICGSDGVNINGKNGLACLINMNTLPEKITIRPLPGLPVVRDLVVDMNQFYEQYEKVHPYL
INDQPAPPTERLQSPEDREKLNGLYECILCACCSTSCPSFWWNPDKFLGPSALLNAYRFV
ADSRDSDTQARLARMDDPFSLFRCRGIMNCVAVCPKGLNPTRAIGHLRNLLLEQAG
Download sequence
Identical sequences A5WC28
349106.PsycPRwf_0264 gi|148652076|ref|YP_001279169.1| WP_011959553.1.63326

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]