SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|148652432|ref|YP_001279525.1| from Psychrobacter sp. PRwf-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|148652432|ref|YP_001279525.1|
Domain Number 1 Region: 652-964
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.37e-46
Family RecA protein-like (ATPase-domain) 0.031
Further Details:      
 
Domain Number 2 Region: 994-1056
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.8e-20
Family FtsK C-terminal domain-like 0.00085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|148652432|ref|YP_001279525.1|
Sequence length 1056
Comment cell division protein FtsK [Psychrobacter sp. PRwf-1]
Sequence
MITAHLIYTLKKVTFTLLAVMLAAFVFVILLTYTPNDPSWSRISSDMGQISNMGGAVGAW
VSDLLYTFMGWSAWWLMVFLAYEAVCIWWHREQAFGPLRAIGYVFLLLASCGLVAITPQL
LGLISDNGARFGGILGAEVATRLSGLLTIYGASAFLLVFTLITATFAFNIHWKRVFDAFL
SLSWLGNGLKRQPTVDEASQKGESEMATHVSQEQPEDLAADGSPLMQQLKLNLPESEDDE
AVDLASEPSTAHASNPSLSNVLDDFLVNSGLTESILALQEQEAQEAHQAKSAAQAPVTAA
NGSIAPESSLIKKQEPSFAWNDQDVINELLDEQALPTAVANSVDASSPSMADSSTQTQQA
ADYSVSPSSSEAKAPIDNADNAAPADTHNSDIEQQAFDVYDVKVADTAQAQQETVTDVTD
ESELSINKAATTPSELETDDQTALYDAKDEGGYLDNNNADEDTKLETPLEDVEKNVEPPA
FVDLTPTNTPPSNPKKPHEPQPASEPTQAAPTIRFATPEGDASNHIEDMMPDVDEDEFVL
PEIHDDTAYASTSRAMQTAKYREGLSPIPELSILDKPDPDRKPSYTQQELAQLSELLEIK
LQEFNVKAEVVNAIPGPVVTRFEVDLAPGVKASKVTGISRDLARSLSMASLRVVEVIPGK
PFIGIEVPNKKREMVRLIELLQTEDYKNPKAQISMAMGKDIGGKPIITDLARAPHMLVAG
TTGSGKSVLVNAMLLSMLLKYKPSELRLILIDPKQLELANYNDIPHLLTPVVTDMNEAAS
SLSWCVAEMERRYQLMSLLKVRKLGEFNKKVIAAEKAGRPIIDPLWRPNDSVSIDKAPKL
KTLPMIVIVADEFADMIMQVGKQAEELITRLAQKSRAAGIHLMLATQRPSVDVITGLIKA
NIPVRAALRVNSKVDSRTILDAGGAEDMLGNGDMLFLGPGQIEPDRVHGAYVSDEEVNRV
CDAWRERGAPDYIDNMASNFELTSPSSSGAGNTSGEDDALYDEAVAFVMETRKVSASSIQ
RKFSIGYNRAARIVDSMEEAGLVSSMGKSGKRELLM
Download sequence
Identical sequences A5WD34
gi|148652432|ref|YP_001279525.1| 349106.PsycPRwf_0620 WP_011959900.1.63326

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]