SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|148652814|ref|YP_001279907.1| from Psychrobacter sp. PRwf-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|148652814|ref|YP_001279907.1|
Domain Number 1 Region: 86-169
Classification Level Classification E-value
Superfamily CO dehydrogenase ISP C-domain like 4.84e-24
Family CO dehydrogenase ISP C-domain like 0.00065
Further Details:      
 
Domain Number 2 Region: 3-80
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 9.57e-23
Family 2Fe-2S ferredoxin domains from multidomain proteins 0.00096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|148652814|ref|YP_001279907.1|
Sequence length 264
Comment 2Fe-2S iron-sulfur cluster binding domain-containing protein [Psychrobacter sp. PRwf-1]
Sequence
MTTLSLTINNNLYHFEDLDPRTTLLDLCRHHLQITGPKKGCDHGQCGACTILINGQRINS
CLTLAVMHEGDEITTIEGIGLPETLSDLQQAFKEHDAFQCGYCTPGQICSATALIEEVKQ
NWPSYVTEDLKNPDGALIQEVAERMSGNICRCSAYPNIINAISEVLQKELQKQVNQSKST
HPSSLDNLDNLDNLHNLHNLHNLHNLDSSLDSSGNPSNKPAVSAAVSGIWSPPPSQSQVH
KDQAHKDNANKSINNQSQAIGENS
Download sequence
Identical sequences A5WE66
349106.PsycPRwf_1007 WP_011960277.1.63326 gi|148652814|ref|YP_001279907.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]