SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|525828981|ref|YP_008251975.1| from Salmonella enterica subsp. enterica Serovar Heidelberg str. CFSAN002069

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|525828981|ref|YP_008251975.1|
Domain Number 1 Region: 1-362
Classification Level Classification E-value
Superfamily FMN-linked oxidoreductases 2.42e-110
Family FMN-linked oxidoreductases 0.0000000000475
Further Details:      
 
Domain Number 2 Region: 333-520
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 2.94e-41
Family N-terminal domain of adrenodoxin reductase-like 0.000000929
Further Details:      
 
Domain Number 3 Region: 461-518,556-650
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 5.02e-28
Family C-terminal domain of adrenodoxin reductase-like 0.00000126
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|525828981|ref|YP_008251975.1|
Sequence length 672
Comment 2,4-dienoyl-CoA reductase [Salmonella enterica subsp. enterica serovar Heidelberg str. CFSAN002069]
Sequence
MSYPSLFAPLDLGFTTLRNRVLMGSMHTGLEEHPDGAERLAAFYAERARHGVALIVTGGI
APVPSGVVMTGGAMLNDASQLTPHRVVTDAVHAQGGKIALQILHTGRYSYQPHLVAPSAI
QAPINRFMPHELTHGEILQLIDDFAHCAQLAREAGYDGVEVMGSEGYLINEFLTRRTNHR
DDEWGGDYASRMRFAVEVVRAVRQRVGNDFIIIYRLSMLDLVENGGTFDETVQLAQAIEA
AGASLINTGIGWHEARIPTIATPVPRGAFSWVTRKLKGHVSVPLIATNRINDPQVAETIL
TRGDADMVSMARPFLADAEFLTKAQSGRADEINTCIGCNQACLDRIFIGKVTSCLVNPRA
CHETHMPITPAIRKKNLAVVGAGPAGLAFAINAASRGHHVTLFDAQSEIGGQFTIARQIP
GKEEFYETLRYYRRMIDVTGVTLKLNQRVNAEDLQPFDEAILACGIVPRRPPIDGIDHPK
VLTYLEVLRDKAPVGKRVAIIGCGGIGFDTAMYLSQHGESTSQNIAEFCTEWGIDTSLQQ
AGGLRPEGPRLARSPRQIVMLQRKASKPGEGLGKTTGWIHRATLLARGVKMIPAVSYQKI
DDDGLHLLIGGEPQLLEVDHVVICAGQEPRRELADPLRAAGKTVHLIGGCDVAMELDARR
AIAQGTRLALEI
Download sequence
Identical sequences A0A265B3L7 A0A2K2QWR7
gi|194451080|ref|YP_002047256.1| ABEL01000006|CDS_113272-115290 ABFH02000001|CDS_1775511-1773493 CP001120|CDS_3408613-3410631 gi|525828981|ref|YP_008251975.1| gi|525814504|ref|YP_008244522.1| WP_000121536.1.100730 WP_000121536.1.101042 WP_000121536.1.101185 WP_000121536.1.1013 WP_000121536.1.101841 WP_000121536.1.10191 WP_000121536.1.10231 WP_000121536.1.10521 WP_000121536.1.10566 WP_000121536.1.1110 WP_000121536.1.11156 WP_000121536.1.11588 WP_000121536.1.11677 WP_000121536.1.11687 WP_000121536.1.11735 WP_000121536.1.11834 WP_000121536.1.12017 WP_000121536.1.12718 WP_000121536.1.13207 WP_000121536.1.13661 WP_000121536.1.14111 WP_000121536.1.14436 WP_000121536.1.14458 WP_000121536.1.14618 WP_000121536.1.15046 WP_000121536.1.15862 WP_000121536.1.15910 WP_000121536.1.15986 WP_000121536.1.16004 WP_000121536.1.16047 WP_000121536.1.16361 WP_000121536.1.16525 WP_000121536.1.16873 WP_000121536.1.16903 WP_000121536.1.17093 WP_000121536.1.17743 WP_000121536.1.17891 WP_000121536.1.1798 WP_000121536.1.18122 WP_000121536.1.1818 WP_000121536.1.18254 WP_000121536.1.19273 WP_000121536.1.19588 WP_000121536.1.19616 WP_000121536.1.19793 WP_000121536.1.19975 WP_000121536.1.20446 WP_000121536.1.20614 WP_000121536.1.21136 WP_000121536.1.21351 WP_000121536.1.21991 WP_000121536.1.22235 WP_000121536.1.22692 WP_000121536.1.22758 WP_000121536.1.22864 WP_000121536.1.23379 WP_000121536.1.23509 WP_000121536.1.23959 WP_000121536.1.24082 WP_000121536.1.25119 WP_000121536.1.26741 WP_000121536.1.26919 WP_000121536.1.27084 WP_000121536.1.27223 WP_000121536.1.27544 WP_000121536.1.28032 WP_000121536.1.29113 WP_000121536.1.29509 WP_000121536.1.29827 WP_000121536.1.29990 WP_000121536.1.30022 WP_000121536.1.30202 WP_000121536.1.30238 WP_000121536.1.31092 WP_000121536.1.31122 WP_000121536.1.31451 WP_000121536.1.31854 WP_000121536.1.32260 WP_000121536.1.32408 WP_000121536.1.33580 WP_000121536.1.3394 WP_000121536.1.34417 WP_000121536.1.35193 WP_000121536.1.35892 WP_000121536.1.36017 WP_000121536.1.36547 WP_000121536.1.36899 WP_000121536.1.3756 WP_000121536.1.38393 WP_000121536.1.38569 WP_000121536.1.38781 WP_000121536.1.39265 WP_000121536.1.39553 WP_000121536.1.39584 WP_000121536.1.39724 WP_000121536.1.40341 WP_000121536.1.40996 WP_000121536.1.41018 WP_000121536.1.42156 WP_000121536.1.4222 WP_000121536.1.42243 WP_000121536.1.42444 WP_000121536.1.42676 WP_000121536.1.43077 WP_000121536.1.43339 WP_000121536.1.43371 WP_000121536.1.43528 WP_000121536.1.43778 WP_000121536.1.43951 WP_000121536.1.44300 WP_000121536.1.44433 WP_000121536.1.44933 WP_000121536.1.45145 WP_000121536.1.45434 WP_000121536.1.45582 WP_000121536.1.45622 WP_000121536.1.45848 WP_000121536.1.46278 WP_000121536.1.46434 WP_000121536.1.47008 WP_000121536.1.47579 WP_000121536.1.48876 WP_000121536.1.49113 WP_000121536.1.49686 WP_000121536.1.50404 WP_000121536.1.50576 WP_000121536.1.50999 WP_000121536.1.51066 WP_000121536.1.51224 WP_000121536.1.51831 WP_000121536.1.52047 WP_000121536.1.52170 WP_000121536.1.52336 WP_000121536.1.52692 WP_000121536.1.52866 WP_000121536.1.52949 WP_000121536.1.52985 WP_000121536.1.53272 WP_000121536.1.53905 WP_000121536.1.54526 WP_000121536.1.55325 WP_000121536.1.55430 WP_000121536.1.5560 WP_000121536.1.55973 WP_000121536.1.56244 WP_000121536.1.56559 WP_000121536.1.56660 WP_000121536.1.57356 WP_000121536.1.58358 WP_000121536.1.58407 WP_000121536.1.59420 WP_000121536.1.60545 WP_000121536.1.60561 WP_000121536.1.60772 WP_000121536.1.61201 WP_000121536.1.62020 WP_000121536.1.62076 WP_000121536.1.6209 WP_000121536.1.62257 WP_000121536.1.63797 WP_000121536.1.64018 WP_000121536.1.64387 WP_000121536.1.64894 WP_000121536.1.64920 WP_000121536.1.65269 WP_000121536.1.65940 WP_000121536.1.65956 WP_000121536.1.66049 WP_000121536.1.66330 WP_000121536.1.66678 WP_000121536.1.67100 WP_000121536.1.67235 WP_000121536.1.6739 WP_000121536.1.67942 WP_000121536.1.68401 WP_000121536.1.69001 WP_000121536.1.6904 WP_000121536.1.69151 WP_000121536.1.69359 WP_000121536.1.6954 WP_000121536.1.69758 WP_000121536.1.70488 WP_000121536.1.70580 WP_000121536.1.70959 WP_000121536.1.71010 WP_000121536.1.71023 WP_000121536.1.71363 WP_000121536.1.71636 WP_000121536.1.71798 WP_000121536.1.72403 WP_000121536.1.72728 WP_000121536.1.72872 WP_000121536.1.73125 WP_000121536.1.73461 WP_000121536.1.73847 WP_000121536.1.745 WP_000121536.1.76327 WP_000121536.1.77177 WP_000121536.1.77267 WP_000121536.1.77414 WP_000121536.1.77710 WP_000121536.1.78372 WP_000121536.1.78838 WP_000121536.1.79734 WP_000121536.1.80741 WP_000121536.1.81305 WP_000121536.1.81328 WP_000121536.1.81528 WP_000121536.1.81735 WP_000121536.1.81760 WP_000121536.1.82192 WP_000121536.1.82232 WP_000121536.1.82464 WP_000121536.1.82529 WP_000121536.1.84291 WP_000121536.1.84397 WP_000121536.1.85568 WP_000121536.1.86043 WP_000121536.1.86173 WP_000121536.1.8671 WP_000121536.1.87695 WP_000121536.1.87899 WP_000121536.1.8792 WP_000121536.1.88092 WP_000121536.1.88957 WP_000121536.1.88980 WP_000121536.1.89114 WP_000121536.1.89119 WP_000121536.1.89657 WP_000121536.1.89765 WP_000121536.1.89817 WP_000121536.1.9002 WP_000121536.1.91056 WP_000121536.1.91179 WP_000121536.1.91621 WP_000121536.1.92165 WP_000121536.1.92893 WP_000121536.1.93059 WP_000121536.1.93339 WP_000121536.1.93937 WP_000121536.1.94352 WP_000121536.1.94655 WP_000121536.1.95248 WP_000121536.1.95277 WP_000121536.1.95388 WP_000121536.1.95670 WP_000121536.1.95691 WP_000121536.1.95939 WP_000121536.1.96004 WP_000121536.1.96162 WP_000121536.1.9674 WP_000121536.1.97047 WP_000121536.1.97143 WP_000121536.1.97297 WP_000121536.1.97477 WP_000121536.1.97487 WP_000121536.1.97631 WP_000121536.1.9799 WP_000121536.1.9826 WP_000121536.1.98314 WP_000121536.1.99626 454169.SeHA_C3514 gi|386592914|ref|YP_006089314.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]