SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|479203313|ref|YP_007831904.1| from Roseburia intestinalis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|479203313|ref|YP_007831904.1|
Domain Number 1 Region: 1-65
Classification Level Classification E-value
Superfamily L28p-like 5.89e-27
Family Ribosomal protein L31p 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|479203313|ref|YP_007831904.1|
Sequence length 67
Comment LSU ribosomal protein L31P [Roseburia intestinalis M50/1]
Sequence
MREGIHPDYYQATVTCNCGNTFVTGSTKEDIHVEICSKCHPFYTGQQKSARTDGRIDKFN
KKYGINK
Download sequence
Identical sequences A0A173R1Z5 C7GGJ3 D4KPR1 D4KVG7 R6BDD7
WP_006859131.1.14300 WP_006859131.1.8661 gi|479203313|ref|YP_007831904.1| gi|479146705|ref|YP_007777134.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]