SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|479203807|ref|YP_007832398.1| from Roseburia intestinalis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|479203807|ref|YP_007832398.1|
Domain Number 1 Region: 1-60
Classification Level Classification E-value
Superfamily L28p-like 4.12e-21
Family Ribosomal protein L28 0.00042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|479203807|ref|YP_007832398.1|
Sequence length 61
Comment LSU ribosomal protein L28P [Roseburia intestinalis M50/1]
Sequence
MAKCAVCGKGAHFGNNVSHSHRRSNRMWKSNIKRVSCKVNGTPKKLYVCASCLKSGKVER
A
Download sequence
Identical sequences A0A173SQH3 A0A1Q6UXC4 C7G7M4 D4KR55 R6B135
gi|479203807|ref|YP_007832398.1| WP_006856028.1.14300 WP_006856028.1.73573 WP_006856028.1.8661

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]