SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|479201929|ref|YP_007830520.1| from Roseburia intestinalis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|479201929|ref|YP_007830520.1|
Domain Number 1 Region: 89-356
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 8.05e-35
Family L-arabinose binding protein-like 0.0019
Further Details:      
 
Domain Number 2 Region: 6-76
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.59e-18
Family GntR-like transcriptional regulators 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|479201929|ref|YP_007830520.1|
Sequence length 361
Comment Transcriptional regulators [Roseburia intestinalis M50/1]
Sequence
MGKTIMYERIYADLLAKIQNGDYQPGDRLPSEKESAELYGVSRITAKKAMDMLAKEKKIS
REPGRGSFVCSPAAAVEMKKESRGTANQRIGVIFDGFGSDFGTRLLQGIESECDRRQSDL
LFKCTYGSIEKEKQAIDAAIRAGVKGILLLCAQGDNYNSKVLELALNGYPLVLMDRRMQG
ISIPCVRTDNYEAANEVTKILIAMGHKKICFLTHASVTTTTIHERYEGFAHCMLKYEDAN
GTFAKLEKYNHIPEDIEKECREFDYAQIAEILEKNRECTAYIAAEYRIGVLFSKYLKEHG
ISKKIAVFDGIDEIYEQDDFIHVRQNEFAMGQQAVTLLEEITTGKKQIDDILIPYQISGI
L
Download sequence
Identical sequences D4KKS7
gi|479201929|ref|YP_007830520.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]